Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS03540 [old locus tag: SP_0723 ]
- pan locus tag?: PNEUPAN001645000
- symbol: thiW
- pan gene symbol?: thiW
- synonym:
- product: energy coupling factor transporter S component ThiW
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS03540 [old locus tag: SP_0723 ]
- symbol: thiW
- product: energy coupling factor transporter S component ThiW
- replicon: chromosome
- strand: +
- coordinates: 688306..688830
- length: 525
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (688306..688830) NCBI
- BioCyc:
- MicrobesOnline: see SP_0723
- PneumoBrowse for strain D39V: SPV_0629 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAGAAAGCACCAATTACAAGTTCACAAATTAACCATTTTATCTATGATGATTGCCCTT
GATGTAGTCCTTACACCTATCTTTCGAATTGAGGGAATGGCACCGATGTCCAGTGTAGTC
AATATTCTAGCAGGAATCATGATGGGACCTGTTTATGCCTTGGCTATGGCTACAGTCACA
GCCTTTATCCGTATGACGACTCAAGGGATTCCGCCTTTAGCTCTCACAGGAGCGACTTTT
GGAGCCCTTCTAGCAGGTCTCTTTTATAAGTACGGTCGAAAATTTCACTATTCTGCTCTA
GGAGAGATTTTGGGAACAGGTATTATTGGTTCCATTGTTTCCTATCCTGTTATGGTACTC
TTTACAGGATCAGCTGCTAAGCTTAGCTGGTTTATCTACACGCCTCGATTTTTCGGAGCA
ACCTTGATTGGTACAGCGATTTCCTTTATTGCCTTTCGATTTTTAATCAAGCAGGAATTC
TTTAAAAAAGTGCAGGGATATTTCTTTAGTGAAAGGATAGACTGA60
120
180
240
300
360
420
480
525
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS03540 [old locus tag: SP_0723 ]
- symbol: ThiW
- description: energy coupling factor transporter S component ThiW
- length: 174
- theoretical pI: 10.5351
- theoretical MW: 19195
- GRAVY: 0.752874
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine energy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 147.8)Transport and binding proteins Other energy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 147.8)and 1 moreTransport and binding proteins Unknown substrate ECF transporter S component, folate family (TIGR04518; HMM-score: 30.7)
- TheSEED: see SP_0723
- PFAM: Gx_transp (CL0315) ThiW; Thiamine-precursor transporter protein (ThiW) (PF09512; HMM-score: 163.2)and 4 moreECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 36.7)5TM-5TMR_LYT; 5TMR of 5TMR-LYT (PF07694; HMM-score: 22.4)no clan defined PAP_assoc; Cid1 family poly A polymerase (PF03828; HMM-score: 12)SNARE_assoc; SNARE associated Golgi protein (PF09335; HMM-score: 7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9982
- Cell wall & surface Score: 0
- Extracellular Score: 0.0016
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.177658
- TAT(Tat/SPI): 0.001409
- LIPO(Sec/SPII): 0.01155
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAGIMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFHYSALGEILGTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKKVQGYFFSERID
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS03520 > SP_RS03525 > SP_RS03530 > tenA > thiW > SP_RS03545 > thiE
⊟Regulation[edit | edit source]
- regulator: THI-box see SP_0723
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0629 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)