Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS08065 [old locus tag: SP_1636 ]
- pan locus tag?: PNEUPAN003045000
- symbol: SP_RS08065
- pan gene symbol?: sifR
- synonym:
- product: Rrf2 family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS08065 [old locus tag: SP_1636 ]
- symbol: SP_RS08065
- product: Rrf2 family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1535882..1536319
- length: 438
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (1535882..1536319) NCBI
- BioCyc:
- MicrobesOnline: see SP_1636
- PneumoBrowse for strain D39V: SPV_1448 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCAAATTCCAAGTAGATTTACCATTGCGACTCATATGCTGATAATCATTGCCCTCGAG
GGGAAGGAAAGCAAGGTGACCAGTGATTTTCTGGCTGCTAGTGTCGGGGTCAATCCTGTC
ATTATCAGAAAGATCTTGTCCCAGTTGAAGAAGGCAGAGCTGATTTCAGTAGCGCGTGGA
ACGGGCGGAACAGAGATTGTCAAGGACCTTAAGGATATTAGTCTTTTAGATGTTTATCAG
GCGGTCGAATGTCTTGGTAAGACAGGTCAACTCTTCAGTTTCCATGACAATCCGAATCCA
AATTGCCCTGTAGGAGCTCATATTCATGATGTTTTGGATCAAAAATTGGAGAGAATTCAG
TTGACTATGGAGGCAGAACTTGGTCAAACCAGTCTAGAAAAAGTCGTGGCCGATGCAGAG
AGTCAGATGAAGGATTAA60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS08065 [old locus tag: SP_1636 ]
- symbol: SP_RS08065
- description: Rrf2 family transcriptional regulator
- length: 145
- theoretical pI: 5.6206
- theoretical MW: 15824.2
- GRAVY: 0.0317241
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 55.2)and 7 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 33.5)Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 33.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 21.4)Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 21.4)Transcription Transcription factors transcription factor E (TIGR00373; HMM-score: 13.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13.5)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13.5)
- TheSEED: see SP_1636
- PFAM: HTH (CL0123) Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 116.7)and 7 moreTFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 23.1)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 19.6)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 15.8)Put_DNA-bind_N; Putative DNA-binding protein N-terminus (PF06971; HMM-score: 13.9)HTH_11; HTH domain (PF08279; HMM-score: 13.5)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 13.3)HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9872
- Cytoplasmic Membrane Score: 0.0023
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0101
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.048161
- TAT(Tat/SPI): 0.003241
- LIPO(Sec/SPII): 0.045487
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVADAESQMKD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site: see SP_1636
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1448 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)