Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS12820 [old locus tag: SP_1321 ]
- pan locus tag?: PNEUPAN000205000
- symbol: SP_RS12820
- pan gene symbol?: ntpK
- synonym:
- product: V-type ATP synthase subunit K
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS12820 [old locus tag: SP_1321 ]
- symbol: SP_RS12820
- product: V-type ATP synthase subunit K
- replicon: chromosome
- strand: -
- coordinates: 1244392..1244868
- length: 477
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (1244392..1244868) NCBI
- BioCyc:
- MicrobesOnline: see SP_1321
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGAACATTTAGCAACTTATTTTTCAACCTATGGAGGAGCTTTCTTCGCTGCATTGGGA
ATTGTATTGGCGGTTGGATTAAGCGGTATGGGGTCTGCTTATGGAGTTGGTAAGGCTGGG
CAATCTGCCGCAGCTTTACTGAAAGAACAGCCTGAAAAGTTTGCCTCAGCTTTGATATTG
CAATTATTGCCCGGAACACAAGGATTATATGGTTTTGTTATTGGAATTTTAATTTGGTTG
CAATTAACTCCAGAACTTCCTTTAGAAAAAGGCGTTGCTTATTTCTTTGTAGCTCTTCCA
ATTGCTATTGTAGGATACTTTTCAGCTAAGCATCAAGGAAATGTAGCAGTAGCGGGAATG
CAAATCTTGGCTAAAAGACCAAAAGAATTCATGAAGGGAGCAATTTTAGCTGCCATGGTA
GAAACCTATGCAATTCTTGCTTTTGTCGTATCATTCATTTTGACCCTTCGTGTATAA60
120
180
240
300
360
420
477
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS12820 [old locus tag: SP_1321 ]
- symbol: SP_RS12820
- description: V-type ATP synthase subunit K
- length: 158
- theoretical pI: 9.58387
- theoretical MW: 16702.8
- GRAVY: 0.857595
⊟Function[edit | edit source]
- reaction: EC 7.1.2.2? ExPASynon-specified enzyme name
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds V-type ATPase, C subunit (TIGR01100; EC 3.6.3.14; HMM-score: 36.7)and 1 morealternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 20.6)
- TheSEED: see SP_1321
- PFAM: no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 100.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9902
- Cell wall & surface Score: 0
- Extracellular Score: 0.0094
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.303348
- TAT(Tat/SPI): 0.093051
- LIPO(Sec/SPII): 0.084469
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEHLATYFSTYGGAFFAALGIVLAVGLSGMGSAYGVGKAGQSAAALLKEQPEKFASALILQLLPGTQGLYGFVIGILIWLQLTPELPLEKGVAYFFVALPIAIVGYFSAKHQGNVAVAGMQILAKRPKEFMKGAILAAMVETYAILAFVVSFILTLRV
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS06455 < SP_RS06460 < SP_RS06465 < SP_RS06470 < SP_RS06475 < SP_RS06480 < SP_RS12820 < SP_RS06490 < SP_RS06495 < SP_RS06500 < SP_RS06505 < SP_RS06510 < SP_RS06515 < SP_RS06520 < SP_RS06525 < SP_RS06530 < SP_RS06535Rockhopper [1] : SP_RS06455 < SP_RS06460 < SP_RS06465 < SP_RS06470 < SP_RS06475 < SP_RS06480 < SP_RS12820 < SP_RS06490 < SP_RS06495 < SP_RS06500
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)