Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A026
- locus tag: T308_00540 [new locus tag: T308_RS12990 ]
- pan locus tag?: PNEUPAN000781000
- symbol: T308_00540
- pan gene symbol?: rtgU
- synonym:
- product: membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: T308_00540 [new locus tag: T308_RS12990 ]
- symbol: T308_00540
- product: membrane protein
- replicon: chromosome
- strand: +
- coordinates: 101389..101571
- length: 183
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP006844 (101389..101571) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2102 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGGTATTAAAATGGAAAAAATTTTTGTTATTATTTTTTTTGTATGTTTATTTATATCA
TCCATAACTTTTTTAGCCTATGATTTTGTTAGCGAAGAAATAAAAAAGTTGATTATTTGG
ATGAATGTCGTTTTTTTGATTTTAATCATAGCAATGATAATTTATCCAAAATTAAGAAAA
TGA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: T308_00540 [new locus tag: T308_RS12990 ]
- symbol: T308_00540
- description: membrane protein
- length: 60
- theoretical pI: 9.75396
- theoretical MW: 7147.98
- GRAVY: 1.435
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 6.4)
- TheSEED:
- PFAM: no clan defined FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 12.7)Frag1-like (CL0412) DUF998; Protein of unknown function (DUF998) (PF06197; HMM-score: 12.5)Transporter (CL0375) L_HMGIC_fpl; Lipoma HMGIC fusion partner-like protein (PF10242; HMM-score: 11.6)no clan defined DUF6703; Family of unknown function (DUF6703) (PF20444; HMM-score: 10.9)DUF6768; Family of unknown function (DUF6768) (PF20556; HMM-score: 10.2)and 2 moreZn_Beta_Ribbon (CL0167) DUF2116; Uncharacterized protein containing a Zn-ribbon (DUF2116) (PF09889; HMM-score: 6.6)no clan defined DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 5.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9612
- Cell wall & surface Score: 0
- Extracellular Score: 0.0387
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.024586
- TAT(Tat/SPI): 0.000345
- LIPO(Sec/SPII): 0.125175
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: AGZ46946 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MGIKMEKIFVIIFFVCLFISSITFLAYDFVSEEIKKLIIWMNVVFLILIIAMIIYPKLRK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2102 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]