Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A026
- locus tag: T308_RS00500 [old locus tag: T308_00500 ]
- pan locus tag?: PNEUPAN000766000
- symbol: T308_RS00500
- pan gene symbol?: lagD_2
- synonym:
- product: cysteine peptidase family C39 domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: T308_RS00500 [old locus tag: T308_00500 ]
- symbol: T308_RS00500
- product: cysteine peptidase family C39 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 95941..96279
- length: 339
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTAAAAAAATATCCTTGTACGATGCAACATGATCAGTCAGATTGTGCTGCGGCAGTT
GTTTCAACAGTTCTTTTATCTTACAAAAAGGAACTATCAATCATGAAGATTCGGGAAATT
ATTGGTACAGACATGTATGGAACGACTGTCAGTGGTATTGTTTCAGGTCTGAATAAGTTG
AATTTTACAGTAAAAGCTGTTCGAGTAGCACTGGAAGATTTGACTCCAAAATTAACATTT
CCTGCGATTCTTCAAGTTAAGAATGATTTAGGTCAAAATCATTTTGTGGTATTACATAGT
ATAAAGGAGAAAATAAAGGGAACTCGTATTACCAAATAA60
120
180
240
300
339
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: T308_RS00500 [old locus tag: T308_00500 ]
- symbol: T308_RS00500
- description: cysteine peptidase family C39 domain-containing protein
- length: 112
- theoretical pI: 10.1646
- theoretical MW: 12434.7
- GRAVY: 0.0633929
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 48.5)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 48.5)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 48.5)and 2 moreCellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 32.9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 32.9)
- TheSEED:
- PFAM: Peptidase_CA (CL0125) Peptidase_C39; Peptidase C39 family (PF03412; HMM-score: 76.8)and 1 morePeptidase_C39_2; Peptidase_C39 like family (PF13529; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8347
- Cytoplasmic Membrane Score: 0.1026
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.061
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005392
- TAT(Tat/SPI): 0.000296
- LIPO(Sec/SPII): 0.001382
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000915345 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKKYPCTMQHDQSDCAAAVVSTVLLSYKKELSIMKIREIIGTDMYGTTVSGIVSGLNKLNFTVKAVRVALEDLTPKLTFPAILQVKNDLGQNHFVVLHSIKEKIKGTRITK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]