Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A026
- locus tag: T308_RS06045 [old locus tag: T308_05955 ]
- pan locus tag?: PNEUPAN001909000
- symbol: lspA
- pan gene symbol?: lspA
- synonym:
- product: signal peptidase II
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: T308_RS06045 [old locus tag: T308_05955 ]
- symbol: lspA
- product: signal peptidase II
- replicon: chromosome
- strand: -
- coordinates: 1166409..1166870
- length: 462
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_022655 (1166409..1166870) NCBI
- BioCyc: T308_RS06045 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0819 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAAAAAGAGCAATAGTGGCAGTCATTGTACTGCTTTTAATTGGGCTGGATCAGTTG
GTCAAATCCTATATCGTCCAGCAGATTCCACTGGGTGAAGTGCGCTCCTGGATTCCCAAT
TTCGTTAGCTTGACCTACCTGCAAAATCGAGGTGCAGCCTTTTCTATCTTACAAGATCAG
CAGCTGTTATTCGCTGTCATTACTCTGGTTGTCGTGATAGGTGCCATTTGGTATTTACAT
AAACACATGGAGGACTCATTCTGGATGGTCTTGGGTTTGACTCTAATAATCGCGGGTGGT
CTTGGAAACTTTATTGACAGGGTCAGTCAGGGCTTTGTTGTGGATATGTTCCACCTTGAC
TTTATCAACTTTGCAATTTTCAATGTGGCAGATAGCTATCTGACGGTTGGAGTGATTATT
TTATTGATTGCAATGCTAAAAGAGGAAATAAATGGAAATTAA60
120
180
240
300
360
420
462
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: T308_RS06045 [old locus tag: T308_05955 ]
- symbol: LspA
- description: signal peptidase II
- length: 153
- theoretical pI: 6.23647
- theoretical MW: 17150.3
- GRAVY: 0.903268
⊟Function[edit | edit source]
- reaction: EC 3.4.23.36? ExPASySignal peptidase II Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking signal peptidase II (TIGR00077; EC 3.4.23.36; HMM-score: 121.9)and 1 moreCell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 5.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined Peptidase_A8; Signal peptidase (SPase) II (PF01252; HMM-score: 128.5)and 4 moreDUF6594; Family of unknown function (DUF6594) (PF20237; HMM-score: 11.7)MFS (CL0015) OATP; Organic Anion Transporter Polypeptide (OATP) family (PF03137; HMM-score: 11.2)no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 8.7)TMEM_230_134; Transmembrane proteins 230/134 (PF05915; HMM-score: 8.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9985
- Cell wall & surface Score: 0
- Extracellular Score: 0.0014
- SignalP: Signal peptide SP(Sec/SPI) length 23 aa
- SP(Sec/SPI): 0.501891
- TAT(Tat/SPI): 0.000482
- LIPO(Sec/SPII): 0.044322
- Cleavage Site: CS pos: 23-24. VKS-YI. Pr: 0.4361
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000745389 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSWIPNFVSLTYLQNRGAAFSILQDQQLLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDRVSQGFVVDMFHLDFINFAIFNVADSYLTVGVIILLIAMLKEEINGN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0819 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Suneeta Khandavilli, Karen A Homer, Jose Yuste, Shilpa Basavanna, Timothy Mitchell, Jeremy S Brown
Maturation of Streptococcus pneumoniae lipoproteins by a type II signal peptidase is required for ABC transporter function and full virulence.
Mol Microbiol: 2008, 67(3);541-57
[PubMed:18086214] [WorldCat.org] [DOI] (P p)