Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 07-FEB-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_RS02195 [old locus tag: SPAP_0446 ]
- pan locus tag?: PNEUPAN001297000
- symbol: briC
- pan gene symbol?: briC
- synonym:
- product: biofilm-regulating peptide BriC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_RS02195 [old locus tag: SPAP_0446 ]
- symbol: briC
- product: biofilm-regulating peptide BriC
- replicon: chromosome
- strand: +
- coordinates: 415013..415198
- length: 186
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_014494 (415013..415198) NCBI
- BioCyc: SPAP_RS02195 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0391 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACAGGTACAAATACATTTACAGTTCTTTCAACTGAGGACTTGGAGCAAACTTCAGGT
GGTCTTGCTGTTTGGGAAGATGGATATAGTAGATGGTTATATTATAGAGAATTTGCTCCC
TATATGAGGCAAGGGGCACTTAATTCTTATATAGATGCTTGGAAGTACGGCTTCCGAGCA
GGGTAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_RS02195 [old locus tag: SPAP_0446 ]
- symbol: BriC
- description: biofilm-regulating peptide BriC
- length: 61
- theoretical pI: 4.45541
- theoretical MW: 7042.73
- GRAVY: -0.485246
⊟Function[edit | edit source]
- TIGRFAM: bacteriocin-type signal sequence (TIGR01847; HMM-score: 13.3)class IIb bacteriocin, lactobin A/cerein 7B family (TIGR03949; HMM-score: 12.5)
- TheSEED: see SPAP_0446
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000148169 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTGTNTFTVLSTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQGALNSYIDAWKYGFRAG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0391 PneumoExpress