Style text
LinkCtrl+K
Links
Link important words to other wiki articles or even other websites. It will help readers understand the context.
Okay, got itCite
Structure
Insert
Views
ParagraphCtrl+0HeadingCtrl+2Sub-heading 1Ctrl+3Sub-heading 2Ctrl+4Sub-heading 3Ctrl+5Sub-heading 4Ctrl+6Header cellContent cellPreformattedCtrl+7Block quoteCtrl+8Page titleCtrl+1
BoldCtrl+BItalicCtrl+ISuperscriptCtrl+.SubscriptCtrl+,Computer codeCtrl+Shift+6StrikethroughCtrl+Shift+5UnderlineCtrl+UBigSmallLanguageRemoveCtrl+\, Ctrl+MMore
Read the user guideKeyboard shortcutsCtrl+/, Ctrl+Shift+/Toolbar searchCtrl+Shift+P, Ctrl+Alt+Shift+PMore
2 noticesClose
Warning: You are not logged in. Your IP address will be publicly visible if you make any edits. If you log in or create an account, your edits will be attributed to your username, along with other benefits.
You are using a browser which is not officially supported by this editor.
From PneumoWiki
Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 20-DEC-2020
⊟Summary[edit | edit source]
Contents
- organism: Streptococcus pneumoniae OXC141
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- pan locus tag?: PNEUPAN001715000
- symbol: SPNOXC_RS03640
- pan gene symbol?: livF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- symbol: SPNOXC_RS03640
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 682129..682839
- length: 711
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_017592 (682129..682839) NCBI
- BioCyc: SPNOXC_RS03640 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0656 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCTATGTTAAAAGTTGAAAATCTTTCTGTGCATTACGGTATGATCCAAGCAGTTCGT
GATGTAAGCTTTGAAGTTAATGAAGGAGAAGTTGTTTCCCTTATCGGTGCCAACGGTGCA
GGTAAGACAACTATTCTTCGCACCTTGTCAGGTTTGGTTCGACCAAGTTCAGGAAAGATT
GAATTTTTAGGTCAAGAAATCCAAAAAATGCCAGCTCAGAAAATCGTGGCAAGTGGTCTT
TCACAAGTTCCAGAAGGACGCCACGTCTTTCCTGGCTTGACTGTTATGGAAAATCTTGAA
ATGGGAGCTTTCTTAAAGAAAAATCGTGAAGAAAATCAAGCTAACTTGAAGAAGGTTTTC
TCACGCTTTCCTCGTCTTGAAGAACGGAAGAACCAAGATGCAGCCACTCTTTCAGGGGGG
GAACAACAAATGCTTGCCATGGGACGCGCCCTCATGTCAACACCAAAACTTCTTCTTTTA
GATGAACCATCAATGGGACTTGCCCCAATCTTTATCCAAGAAATTTTTGATATCATTCAA
GATATTCAGAAGCAAGGAACAACGGTCCTCTTGATTGAACAAAATGCCAATAAAGCACTT
GCAATCTCTGACCGAGGATATGTACTGGAAACAGGGAAAATCGTCCTATCAGGAACAGGA
AAAGAACTCGCTTCATCAGAAGAAGTCAGAAAAGCATATCTAGGTGGCTAA60
120
180
240
300
360
420
480
540
600
660
711
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- symbol: SPNOXC_RS03640
- description: ABC transporter ATP-binding protein
- length: 236
- theoretical pI: 7.67922
- theoretical MW: 25716.6
- GRAVY: -0.110169
⊟Function[edit | edit source]
- ⊞⊞TIGRFAM: Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 225.8)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 187)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 187)and 73 moreMetabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 159.3)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 155.1)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 142.8)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 131)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 130)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 122)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 121.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 121.5)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120.8)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 120.1)Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 119.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 118.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 113.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 112.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 112.7)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 112.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 110.4)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 110)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 110)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 109.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 109.2)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 108)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 108)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 107.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 99.6)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.8)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 94.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 94.2)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 93.3)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 92.4)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 91.6)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.5)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 90.3)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 90.2)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.7)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.7)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87.3)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 85.6)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 83.9)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 82.5)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.5)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 77.3)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 72.8)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 68.7)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 66.9)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 64.5)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 61.4)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.9)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 46)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 46)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.4)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 37.4)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36.2)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 18.3)Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 16.1)Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 13.3)Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.6)
- TheSEED: see SPNOXC06820
- ⊞⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.2)and 21 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 45.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.3)AAA_23; AAA domain (PF13476; HMM-score: 20.5)AAA_30; AAA domain (PF13604; HMM-score: 18.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.6)BCA_ABC_TP_C; Branched-chain amino acid ATP-binding cassette transporter (PF12399; HMM-score: 14.9)AAA_27; AAA domain (PF13514; HMM-score: 14.7)AAA_28; AAA domain (PF13521; HMM-score: 14.2)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 14)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.6)AAA_33; AAA domain (PF13671; HMM-score: 13.1)AAA_22; AAA domain (PF13401; HMM-score: 13)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.4)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.3)AAA_25; AAA domain (PF13481; HMM-score: 12.2)AAA_13; AAA domain (PF13166; HMM-score: 10.3)DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000062223 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0656 PneumoExpress
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
NCBI: 20-DEC-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae OXC141
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- pan locus tag?: PNEUPAN001715000
- symbol: SPNOXC_RS03640
- pan gene symbol?: livF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- symbol: SPNOXC_RS03640
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 682129..682839
- length: 711
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_017592 (682129..682839) NCBI
- BioCyc: SPNOXC_RS03640 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0656 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit
]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCTATGTTAAAAGTTGAAAATCTTTCTGTGCATTACGGTATGATCCAAGCAGTTCGT
GATGTAAGCTTTGAAGTTAATGAAGGAGAAGTTGTTTCCCTTATCGGTGCCAACGGTGCA
GGTAAGACAACTATTCTTCGCACCTTGTCAGGTTTGGTTCGACCAAGTTCAGGAAAGATT
GAATTTTTAGGTCAAGAAATCCAAAAAATGCCAGCTCAGAAAATCGTGGCAAGTGGTCTT
TCACAAGTTCCAGAAGGACGCCACGTCTTTCCTGGCTTGACTGTTATGGAAAATCTTGAA
ATGGGAGCTTTCTTAAAGAAAAATCGTGAAGAAAATCAAGCTAACTTGAAGAAGGTTTTC
TCACGCTTTCCTCGTCTTGAAGAACGGAAGAACCAAGATGCAGCCACTCTTTCAGGGGGG
GAACAACAAATGCTTGCCATGGGACGCGCCCTCATGTCAACACCAAAACTTCTTCTTTTA
GATGAACCATCAATGGGACTTGCCCCAATCTTTATCCAAGAAATTTTTGATATCATTCAA
GATATTCAGAAGCAAGGAACAACGGTCCTCTTGATTGAACAAAATGCCAATAAAGCACTT
GCAATCTCTGACCGAGGATATGTACTGGAAACAGGGAAAATCGTCCTATCAGGAACAGGA
AAAGAACTCGCTTCATCAGAAGAAGTCAGAAAAGCATATCTAGGTGGCTAA60
120
180
240
300
360
420
480
540
600
660
711
This data comes from external databases and cannot be edited.
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNOXC_RS03640 [old locus tags: SPNOXC06820 SPNOXC_06820 ]
- symbol: SPNOXC_RS03640
- description: ABC transporter ATP-binding protein
- length: 236
- theoretical pI: 7.67922
- theoretical MW: 25716.6
- GRAVY: -0.110169
⊟Function[edit | edit source]
- ⊞TIGRFAM: Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 225.8)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 187)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 187)and 73 moreMetabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 159.3)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 155.1)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 142.8)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 131)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 130)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 122)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 121.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 121.5)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120.8)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 120.1)Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 119.9)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 118.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 113.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 112.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 112.7)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 112.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 110.4)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 110)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 110)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 109.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 109.2)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 108)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 108)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 107.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 99.6)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.8)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 94.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 94.2)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 93.3)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 92.4)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 91.6)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.5)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 90.3)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 90.2)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.7)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.7)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87.3)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 85.6)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 83.9)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 82.5)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.5)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 77.3)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 72.8)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 68.7)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 66.9)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 64.5)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 61.4)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.9)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 46)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 46)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.4)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 37.4)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36.2)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 18.3)Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 16.1)Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 13.3)Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.6)
- TheSEED: see SPNOXC06820
- ⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.2)and 21 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 45.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.3)AAA_23; AAA domain (PF13476; HMM-score: 20.5)AAA_30; AAA domain (PF13604; HMM-score: 18.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.6)BCA_ABC_TP_C; Branched-chain amino acid ATP-binding cassette transporter (PF12399; HMM-score: 14.9)AAA_27; AAA domain (PF13514; HMM-score: 14.7)AAA_28; AAA domain (PF13521; HMM-score: 14.2)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 14)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.6)AAA_33; AAA domain (PF13671; HMM-score: 13.1)AAA_22; AAA domain (PF13401; HMM-score: 13)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.4)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.3)AAA_25; AAA domain (PF13481; HMM-score: 12.2)AAA_13; AAA domain (PF13166; HMM-score: 10.3)DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000062223 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0656 PneumoExpress
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.