Links
Link important words to other wiki articles or even other websites. It will help readers understand the context.
Okay, got itYou are using a browser which is not officially supported by this editor.
⊟Summary[edit | edit source]
Contents
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- pan locus tag?: PNEUPAN001715000
- symbol: SPAP_RS03615
- pan gene symbol?: livF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- symbol: SPAP_RS03615
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 694398..695108
- length: 711
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_014494 (694398..695108) NCBI
- BioCyc: SPAP_RS03615 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0656 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCTATGTTAAAAGTTGAAAATCTTTCTGTGCATTACGGTATGATCCAAGCAGTTCGT
GATGTAAGCTTTGAAGTTAATGAAGGAGAAGTTGTTTCCCTTATCGGTGCCAACGGTGCA
GGTAAGACAACTATTCTTCGCACCTTGTCAGGTTTGGTTCGACCAAGTTCAGGAAAGATT
GAATTTTTAGGTCAAGAAATCCAAAAAATGCCAGCTCAGAAAATCGTGGCAAGTGGTCTT
TCACAAGTTCCAGAAGGACGCCACGTCTTTCCTGGCTTGACTGTTATGGAAAATCTTGAA
ATGGGAGCTTTCTTAAAGAAAAATCGTGAAGAAAATCAAGCTAACTTGAAGAAGGTTTTC
TCACGCTTTCCTCGTCTTGAAGAACGGAAGAACCAAGATGCAGCCACTCTTTCAGGGGGG
GAACAACAAATGCTTGCCATGGGACGCGCCCTCATGTCAACACCAAAACTTCTTCTTTTA
GATGAACCATCAATGGGACTTGCCCCAATCTTTATCCAAGAAATTTTTGATATCATTCAA
GATATTCAGAAGCAAGGAACAACGGTCCTCTTGATTGAACAAAATGCCAATAAAGCACTT
GCAATCTCTGACCGAGGATATGTACTGGAAACAGGGAGAATCGTCCTATCAGGAACAGGA
AAAGAACTCGCTTCATCAGAAGAAGTCAGAAAAGCATATCTAGGTGGCTAA60
120
180
240
300
360
420
480
540
600
660
711
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- symbol: SPAP_RS03615
- description: ABC transporter ATP-binding protein
- length: 236
- theoretical pI: 7.68056
- theoretical MW: 25744.6
- GRAVY: -0.112712
⊟Function[edit | edit source]
- ⊞⊞TIGRFAM: Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 226)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 186.7)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 186.7)and 73 moreMetabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 159.3)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 154.6)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 142.8)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 130.6)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 130.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 121.8)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 121.7)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 121.5)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120.3)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 120.1)Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 119.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 118.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 114.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.5)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 112.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 112.6)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 109.6)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 109.2)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 108.3)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 108.3)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 108.3)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 107.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 99.7)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.2)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.2)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 95)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 94.6)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 93.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 92.4)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 92)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.4)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 91)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 90.2)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.5)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.5)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.6)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 86.6)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 85.6)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 84.9)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 83.3)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.9)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.9)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 79)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 79)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 73.3)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 68.1)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 67)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 64.2)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 63.3)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.7)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 44.8)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 44.8)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.4)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 37)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 18.3)Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 16.1)Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 13.2)Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.6)
- TheSEED: see SPAP_0727
- ⊞⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.2)and 21 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 45.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.3)AAA_23; AAA domain (PF13476; HMM-score: 20.5)AAA_30; AAA domain (PF13604; HMM-score: 18.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.7)BCA_ABC_TP_C; Branched-chain amino acid ATP-binding cassette transporter (PF12399; HMM-score: 15)AAA_27; AAA domain (PF13514; HMM-score: 14.7)AAA_28; AAA domain (PF13521; HMM-score: 14.4)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 14)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.6)AAA_33; AAA domain (PF13671; HMM-score: 13.1)AAA_22; AAA domain (PF13401; HMM-score: 13)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.4)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.3)AAA_25; AAA domain (PF13481; HMM-score: 12.2)AAA_13; AAA domain (PF13166; HMM-score: 10.3)DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000062224 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGRIVLSGTGKELASSEEVRKAYLGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0656 PneumoExpress
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- pan locus tag?: PNEUPAN001715000
- symbol: SPAP_RS03615
- pan gene symbol?: livF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- symbol: SPAP_RS03615
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 694398..695108
- length: 711
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_014494 (694398..695108) NCBI
- BioCyc: SPAP_RS03615 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0656 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit
]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCTATGTTAAAAGTTGAAAATCTTTCTGTGCATTACGGTATGATCCAAGCAGTTCGT
GATGTAAGCTTTGAAGTTAATGAAGGAGAAGTTGTTTCCCTTATCGGTGCCAACGGTGCA
GGTAAGACAACTATTCTTCGCACCTTGTCAGGTTTGGTTCGACCAAGTTCAGGAAAGATT
GAATTTTTAGGTCAAGAAATCCAAAAAATGCCAGCTCAGAAAATCGTGGCAAGTGGTCTT
TCACAAGTTCCAGAAGGACGCCACGTCTTTCCTGGCTTGACTGTTATGGAAAATCTTGAA
ATGGGAGCTTTCTTAAAGAAAAATCGTGAAGAAAATCAAGCTAACTTGAAGAAGGTTTTC
TCACGCTTTCCTCGTCTTGAAGAACGGAAGAACCAAGATGCAGCCACTCTTTCAGGGGGG
GAACAACAAATGCTTGCCATGGGACGCGCCCTCATGTCAACACCAAAACTTCTTCTTTTA
GATGAACCATCAATGGGACTTGCCCCAATCTTTATCCAAGAAATTTTTGATATCATTCAA
GATATTCAGAAGCAAGGAACAACGGTCCTCTTGATTGAACAAAATGCCAATAAAGCACTT
GCAATCTCTGACCGAGGATATGTACTGGAAACAGGGAGAATCGTCCTATCAGGAACAGGA
AAAGAACTCGCTTCATCAGAAGAAGTCAGAAAAGCATATCTAGGTGGCTAA60
120
180
240
300
360
420
480
540
600
660
711
This data comes from external databases and cannot be edited.
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_RS03615 [old locus tag: SPAP_0727 ]
- symbol: SPAP_RS03615
- description: ABC transporter ATP-binding protein
- length: 236
- theoretical pI: 7.68056
- theoretical MW: 25744.6
- GRAVY: -0.112712
⊟Function[edit | edit source]
- ⊞TIGRFAM: Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 226)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 186.7)Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 186.7)and 73 moreMetabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 159.3)Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 154.6)Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 142.8)Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 130.6)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 130.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 121.8)Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 121.7)Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 121.5)Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120.3)Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 120.1)Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 119.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 118.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 114.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 113.5)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 112.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 112.6)Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 109.6)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 109.2)Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 108.6)Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 108.3)Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 108.3)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 108.3)Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 107.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.5)Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 100.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 99.7)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.2)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 95.2)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 95)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 94.6)Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 93.2)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 92.4)Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 92)Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.4)Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 91.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 91)Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 90.2)Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.5)Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 89.5)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.6)Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 86.6)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 85.6)Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 84.9)Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 83.3)Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.9)Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.9)Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.3)Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 79)Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 79)Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 73.3)Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 68.1)Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 67)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 64.2)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 63.3)Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.7)Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 44.8)Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 44.8)Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 39.7)Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.4)Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 37)Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 18.3)Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 16.1)Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 13.2)Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.8)Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.6)
- TheSEED: see SPAP_0727
- ⊞PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.2)and 21 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 45.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.3)AAA_23; AAA domain (PF13476; HMM-score: 20.5)AAA_30; AAA domain (PF13604; HMM-score: 18.6)AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.7)BCA_ABC_TP_C; Branched-chain amino acid ATP-binding cassette transporter (PF12399; HMM-score: 15)AAA_27; AAA domain (PF13514; HMM-score: 14.7)AAA_28; AAA domain (PF13521; HMM-score: 14.4)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 14)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.6)AAA_33; AAA domain (PF13671; HMM-score: 13.1)AAA_22; AAA domain (PF13401; HMM-score: 13)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.4)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.3)AAA_25; AAA domain (PF13481; HMM-score: 12.2)AAA_13; AAA domain (PF13166; HMM-score: 10.3)DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000062224 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVASGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGRIVLSGTGKELASSEEVRKAYLGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0656 PneumoExpress
⊞Biological Material[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Mutants[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Expression vector[edit | edit source]
This data comes from external databases and cannot be edited.
⊟lacZ fusion[edit | edit source]
This data comes from external databases and cannot be edited.
⊟GFP fusion[edit | edit source]
This data comes from external databases and cannot be edited.
⊟two-hybrid system[edit | edit source]
This data comes from external databases and cannot be edited.
⊟FLAG-tag construct[edit | edit source]
This data comes from external databases and cannot be edited.
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.