⊟Summary[edit | edit source]

TIGR4

serotype 4

D39

serotype 2

D39V

serotype 2

Hungary19A-6

serotype 19A

EF3030

serotype 19F

670-6B

serotype 6B

6A-10

serotype 6A

70585

serotype 5

A026

serotype 19F

A66

serotype 3

AP200

serotype 11A

ASP0581

serotype 12F

ATCC 49619

serotype 19F

ATCC 700669

serotype 23F

BM6001

serotype 19F

BVJ1JL

serotype 1

CGSP14

serotype 14

G54

serotype 19F

HU-OH

serotype 3

Hu15

serotype 19A

Hu17

serotype 19A

INV104

serotype 1

INV200

serotype 14

JJA

serotype 14

MDRSPN001

serotype 19F

NCTC7465

serotype 1

NCTC7466

serotype 2

NU83127

serotype 4

OXC141

serotype 3

P1031

serotype 1

R6

serotype 2

SP49

serotype 19A

SPN032672

serotype 1

SPN034156

serotype 3

SPN034183

serotype 3

SPN994038

serotype 3

SPN994039

serotype 3

SPNA45

serotype 3

ST556

serotype 19F

TCH8431/19A

serotype 19A

Taiwan19F-14

serotype 19F

Xen35

serotype 4

gamPNI0373

serotype 1

NCBI: 30-JAN-2014

⊟Summary

• organism: Streptococcus pneumoniae G54
locus tag: SPG_0641
pan locus tag^?:
symbol: SPG_0641
pan gene symbol^?: —
• synonym:
• product: ABC transporter ATP-binding protein, point mutation

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SPG_0641
• symbol: SPG_0641
• product: ABC transporter ATP-binding protein, point mutation
• replicon: chromosome
• strand: -
• coordinates: 630335..630730
• length: 396
• essential: unknown

⊟Accession numbers

• Location: CP001015 (630335..630730) NCBI
• BioCyc:
• MicrobesOnline: 5755910 MicrobesOnline
• PneumoBrowse for strain D39V:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  
  TTGCAATTACTANATCGTGTCGGTTTGCTGGATAAACAACATAGCTTTGCCCGTCAATTA
  TCTGGTGGACAGAAGCAACGTGTTGCAATTGTCCGTGCCCTCCTAATGCATCCAGAAATC
  ATCCTTTTTGACGAGGTGACTGCTTCGCTGGATCCAGAAATGGTGCGTGAGGTGCTGGAA
  CTTATCAATGATTTGGCCCAAGAAGGCCGTACCATGATTTTAGTAACCCACGAAATGCAG
  TTTGCCCAAGCCATTGCTGACCGGATTATCTTCCTCGACCAAGGGAAAATCGCTGAAGAA
  GGAACAGCTCAAGCCTTCTTTACCAATCCGCAAACCAAACGAGCCCAGGAATTTTTAAAC
  GTCTTTGACTTTAGCCAATTTGGCTCATATCTATAA
  60
  120
  180
  240
  300
  360
  396
  

⊟Protein

⊟General

• locus tag: SPG_0641
• symbol: SPG_0641
• description: ABC transporter ATP-binding protein, point mutation
• length: 131
• theoretical pI: 4.89498
• theoretical MW: 14795
• GRAVY: 0.00153846

⊟Function

• ⊞⊞TIGRFAM:
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 159.7)
  and 76 more
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 121.9)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 110.7)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 103.7)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 99.5)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 98.1)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 93.9)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 93.7)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 90.8)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 90.7)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 89.9)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 87.4)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 87.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 85.5)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 84.6)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 83.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 83.2)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 82.7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 82.2)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 81.4)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 79.7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 78.6)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 77.9)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 77.9)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 77.7)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 76.4)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 76.4)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 75.9)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 73)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 72.8)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 71.8)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 71.8)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 71.1)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 71)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 68.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 68.5)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 68.3)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 67.2)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 67.2)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 67.2)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 66.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 66.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 66.4)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 65.7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 65.5)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 65.3)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 65.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 64.6)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 64.1)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 62.1)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 62.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 60.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 59.2)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 59.2)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 57.5)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 57)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 56.9)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 56.9)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 56.9)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 53.5)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 51.3)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 50.5)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 50.5)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 50.2)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 46.5)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 45.1)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 43.1)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 31.8)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 28)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 24.9)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 22)
  putative metalloenzyme radical SAM/SPASM domain maturase (TIGR04311; HMM-score: 13.9)
  Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 12.2)
  Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 12.2)
  Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 12.2)
  Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 12.2)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 11.9)
• TheSEED  :
  • Amino acid ABC transporter, ATP-binding protein
• ⊞⊞PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 39.8)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 33.2)
  and 6 more
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 26.5)
  SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 21)
  Phage-coat (CL0373) Phage_cap_E; Phage major capsid protein E (PF03864; HMM-score: 16.6)
  P-loop_NTPase (CL0023) ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 16.3)
  no clan defined DUF3652; Huntingtin protein region (PF12372; HMM-score: 14.5)
  P-loop_NTPase (CL0023) CobU; Cobinamide kinase / cobinamide phosphate guanyltransferase (PF02283; HMM-score: 13.1)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• ⊞⊞PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.01
  • Cytoplasmic Membrane Score: 9.99
  • Cellwall Score: 0
  • Extracellular Score: 0
  • Internal Helices: 0
• ⊞⊞DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.4571
  • Cytoplasmic Membrane Score: 0.5327
  • Cell wall & surface Score: 0.0002
  • Extracellular Score: 0.01
• ⊞⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.005696
  • TAT(Tat/SPI): 0.000357
  • LIPO(Sec/SPII): 0.000594
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI:
• RefSeq: ACF54945 NCBI
• UniProt:

⊟Protein sequence

• MQLLXRVGLLDKQHSFARQLSGGQKQRVAIVRALLMHPEIILFDEVTASLDPEMVREVLELINDLAQEGRTMILVTHEMQFAQAIADRIIFLDQGKIAEEGTAQAFFTNPQTKRAQEFLNVFDFSQFGSYL

⊟Experimental data

• protein localization:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SPG_0638 < SPG_0639 < SPG_0640 < SPG_0641

⊟Regulation

• regulator:

⊟Expression data

• PneumoExpress for strain D39V:

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You can add further information about the gene and protein here. [edit]

⊟Literature

⊟References

⊟Relevant publications