Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae R6
- locus tag: spr0029 [new locus tag: SPR_RS00160 ]
- pan locus tag?: PNEUPAN000643000
- symbol: spr0029
- pan gene symbol?: —
- synonym:
- product: Degenerate transposase (orf1)
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: spr0029 [new locus tag: SPR_RS00160 ]
- symbol: spr0029
- product: Degenerate transposase (orf1)
- replicon: chromosome
- strand: -
- coordinates: 29624..30016
- length: 393
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE007317 (29624..30016) NCBI
- BioCyc:
- MicrobesOnline: 132914 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0034 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGAACAATTACATTTTATCACAAAATTACTAGACATTAAAGACCCTAATGTCCAGATT
TTAAACATCATCAATAAGGATACACACAAGGAAATCATCGCCAAACTGGACTACGACGCC
CCATCTTGCCCTGAGTGCGGAAACCAATTGAAGAAATATGACTTTCAAAAACCTTCTAAA
ATTCCTTATCTTGAAACGACTGGTATACCTACTAGAATTCTCCTTAGAAAGCGTCGATTC
AAGTGCTATCACTGTTCAAAAATGATGGTCGCTGAAACTTCTGATGACGTACAGTCATAT
TTCTTCTCTTTTTATTATATCACAGTTTTAAATCTAGCTTTACTAGATTCACCGCTACTA
TCTATTTATTCGGAAAAAAGACGAAAAACCTGA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: spr0029 [new locus tag: SPR_RS00160 ]
- symbol: spr0029
- description: Degenerate transposase (orf1)
- length: 130
- theoretical pI: 9.11161
- theoretical MW: 15299.8
- GRAVY: -0.356923
⊟Function[edit | edit source]
- TIGRFAM: cxxc_20_cxxc protein (TIGR04104; HMM-score: 14.9)
- TheSEED :
- Mobile element protein
- PFAM: Zn_Beta_Ribbon (CL0167) zf-ISL3; zinc-finger of transposase IS204/IS1001/IS1096/IS1165 (PF14690; HMM-score: 44.3)and 11 moreZn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 23.1)no clan defined DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 17.4)Zn_Beta_Ribbon (CL0167) zinc_ribbon_9; zinc-ribbon (PF14369; HMM-score: 16.4)DZR; Double zinc ribbon (PF12773; HMM-score: 16.3)Zn_chelatase (CL0687) CxC3; CxC3 like cysteine cluster associated with KDZ transposases (PF18804; HMM-score: 16)C2H2-zf (CL0361) zf-C2HE; C2HE / C2H2 / C2HC zinc-binding finger (PF16278; HMM-score: 15.3)no clan defined DUF6431; Domain of unknown function (DUF6431) (PF20020; HMM-score: 14.6)TRAF (CL0389) zf-ACC; Acetyl-coA carboxylase zinc finger domain (PF17848; HMM-score: 13.7)no clan defined zf-LITAF-like; LITAF-like zinc ribbon domain (PF10601; HMM-score: 13.6)Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 13.4)zf-TFIIB; Transcription factor zinc-finger (PF13453; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.577
- Cytoplasmic Membrane Score: 0.0668
- Cell wall & surface Score: 0.0047
- Extracellular Score: 0.3514
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.024164
- TAT(Tat/SPI): 0.00026
- LIPO(Sec/SPII): 0.001202
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQLHFITKLLDIKDPNVQILNIINKDTHKEIIAKLDYDAPSCPECGNQLKKYDFQKPSKIPYLETTGIPTRILLRKRRFKCYHCSKMMVAETSDDVQSYFFSFYYITVLNLALLDSPLLSIYSEKRRKT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0034 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]