Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae R6
- locus tag: spr0609 [new locus tag: SPR_RS03080 ]
- pan locus tag?: PNEUPAN001608000
- symbol: spr0609
- pan gene symbol?: ABC-NBD-truncation_2
- synonym:
- product: ABC transporter ATP-binding protein - unknown substrate, truncation
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: spr0609 [new locus tag: SPR_RS03080 ]
- symbol: spr0609
- product: ABC transporter ATP-binding protein - unknown substrate, truncation
- replicon: chromosome
- strand: +
- coordinates: 622097..622222
- length: 126
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE007317 (622097..622222) NCBI
- BioCyc: SPR0609 BioCyc
- MicrobesOnline: 133494 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0605 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTTAAGTAAAAATGTAGAATATAAAGGAGGTGCAATGAGTATGATTGAAGTTAGCCAT
TTATCAAAAAGTTTTGGTGATAAAATAGCTTTAAATAATATAAGCTTCACTGTTAAAGAA
GGTTAG60
120
126
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: spr0609 [new locus tag: SPR_RS03080 ]
- symbol: spr0609
- description: ABC transporter ATP-binding protein - unknown substrate, truncation
- length: 41
- theoretical pI: 9.16368
- theoretical MW: 4462.15
- GRAVY: -0.0780488
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 19)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 19)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 16)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 15.6)and 4 moreATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 14.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 13.9)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 12.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 11.3)
- TheSEED :
- hypothetical protein
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7768
- Cytoplasmic Membrane Score: 0.118
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.1045
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.143383
- TAT(Tat/SPI): 0.0055
- LIPO(Sec/SPII): 0.014475
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLSKNVEYKGGAMSMIEVSHLSKSFGDKIALNNISFTVKEG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- see SPR_RS03080
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0605 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]