Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae R6
- locus tag: spr1313 [new locus tag: SPR_RS06555 ]
- pan locus tag?: PNEUPAN002783000
- symbol: spr1313
- pan gene symbol?: aapA
- synonym:
- product: Hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: spr1313 [new locus tag: SPR_RS06555 ]
- symbol: spr1313
- product: Hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1303163..1303399
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE007317 (1303163..1303399) NCBI
- BioCyc: SPR1313 BioCyc
- MicrobesOnline: 134197 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1288 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGAGAAATCATGCTACTGCAACTATTTTCTTTATATTTCGAGAGTTTGATATTGACC
ACCATCCTTGTTCTGATTTTTTTAGGGATTTGGATTGGTCTGAGAGCCATGTCGGGAGTT
GATAAGACAGCCAAGGCTCGCCAAGCCCATCTCTATGATATGATTATGATTGGAGTCTTG
GTTGTCCCAGTATTATCCTTTGCGGTTATGAGTTTAATTCTTGTTTTCAAGGCATAA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: spr1313 [new locus tag: SPR_RS06555 ]
- symbol: spr1313
- description: Hypothetical protein
- length: 78
- theoretical pI: 9.86336
- theoretical MW: 8787.86
- GRAVY: 1.34744
⊟Function[edit | edit source]
- TIGRFAM: TIGR03943 family protein (TIGR03943; HMM-score: 14.4)
- TheSEED :
- FIG01114736: hypothetical protein
- PFAM: no clan defined DUF4059; Protein of unknown function (DUF4059) (PF13268; HMM-score: 105.6)and 1 moreCAF1C_H4-bd; Histone-binding protein RBBP4 or subunit C of CAF1 complex (PF12265; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001594
- TAT(Tat/SPI): 0.000216
- LIPO(Sec/SPII): 0.005084
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MREIMLLQLFSLYFESLILTTILVLIFLGIWIGLRAMSGVDKTAKARQAHLYDMIMIGVLVVPVLSFAVMSLILVFKA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: trxB < spr1313 < ABC-NDB < ABC-MSP
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1288 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.