Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 19-NOV-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A66
- locus tag: A66_00917 [new locus tag: A66_RS04570 ]
- pan locus tag?: PNEUPAN002033000
- symbol: A66_00917
- pan gene symbol?: mscL
- synonym:
- product: Large-conductance mechanosensitive channel
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: A66_00917 [new locus tag: A66_RS04570 ]
- symbol: A66_00917
- product: Large-conductance mechanosensitive channel
- replicon: chromosome
- strand: -
- coordinates: 878660..879037
- length: 378
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: LN847353 (878660..879037) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0896 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAAAAAATCTAAAATCGTTCTTGCTTCGAGGAAATGTTATTGACCTTGCTGTCGGT
GTTGTCATTGCCTCTGCTTTTGGTGCTATCGTTACTTCACTTGTAAACGACATTATCACT
CCTCTTATTTTAAATCCCGCTTTGAAAGCTGCTAAAGTCGAACGTATCGCTCAACTTTCT
TGGCATGGAGTCGGCTATGGTAACTTTTTAAGTGCTATTATCAATTTTATCTTTGTCGGT
ACCGCCCTCTTCTTTATTATCAAGGGCATTGAAAAAGCACAGAAGCTGACTGGCATAAAG
GAAGAAAAAACTGACGAAAAAAAACCAACCGAATTGGAAGTCCTTCAAGAAATAAAAGCT
CTCCTTGAGAAAAAATAA60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: A66_00917 [new locus tag: A66_RS04570 ]
- symbol: A66_00917
- description: Large-conductance mechanosensitive channel
- length: 125
- theoretical pI: 10.1369
- theoretical MW: 13661.2
- GRAVY: 0.4648
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions large conductance mechanosensitive channel protein (TIGR00220; HMM-score: 103.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: Zn_Beta_Ribbon (CL0167) MscL; Large-conductance mechanosensitive channel, MscL (PF01741; HMM-score: 115.7)and 3 moreno clan defined DUF5453; Family of unknown function (DUF5453) (PF17534; HMM-score: 15.8)P-loop_NTPase (CL0023) KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 12.3)MFS (CL0015) OATP; Organic Anion Transporter Polypeptide (OATP) family (PF03137; HMM-score: 10.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9636
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0361
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.21806
- TAT(Tat/SPI): 0.013697
- LIPO(Sec/SPII): 0.016147
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CRI61628 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKNLKSFLLRGNVIDLAVGVVIASAFGAIVTSLVNDIITPLILNPALKAAKVERIAQLSWHGVGYGNFLSAIINFIFVGTALFFIIKGIEKAQKLTGIKEEKTDEKKPTELEVLQEIKALLEKK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0896 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]