Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 03-SEP-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ASP0581
- locus tag: ASP0581_03140 [new locus tag: EL334_RS01690 ]
- pan locus tag?: PNEUPAN001097000
- symbol: ASP0581_03140
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ASP0581_03140 [new locus tag: EL334_RS01690 ]
- symbol: ASP0581_03140
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 295709..296038
- length: 330
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP019192 (295709..296038) NCBI
- BioCyc: see EL334_RS01690
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0282 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCTCATAGTATTTTCTATTTTAGCAACTGTTGAACAATTTAAACTCTATGGAAATAGG
AAAGAAAAGTTGGGAATAACACTAATGTTTGTTAGAATACAAATGCTTATTTCAATAGGA
TTACTTGTTTTAACTTGGACAAGTTGGTTTAAGAATCTTTTTCCGATTTTTGAAAATAAC
CAAGTAGCACGTTTATTTGTTTTTGTAGTTCTTCTATTAGGTTTAGCTCTGAGTTTGTTA
GACATTAGAAGAATTAAAAAAATTTATAAACGAACAGATAAGGCTTATCAACAATTTGTC
CAATTGGAAAAGAACTCACTTAGTTTATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ASP0581_03140 [new locus tag: EL334_RS01690 ]
- symbol: ASP0581_03140
- description: hypothetical protein
- length: 109
- theoretical pI: 10.9405
- theoretical MW: 12812.4
- GRAVY: 0.56789
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for D39, TIGR4
- PFAM: no clan defined Spore_III_AE; Stage III sporulation protein AE (spore_III_AE) (PF09546; HMM-score: 14.8)T_cell_tran_alt; T-cell leukemia translocation-altered (PF15128; HMM-score: 14.7)SieB; Super-infection exclusion protein B (PF14163; HMM-score: 13.7)DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000732
- TAT(Tat/SPI): 0.000119
- LIPO(Sec/SPII): 0.001739
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG80836 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLTWTSWFKNLFPIFENNQVARLFVFVVLLLGLALSLLDIRRIKKIYKRTDKAYQQFVQLEKNSLSL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0282 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.