Jump to navigation
		Jump to search
		
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 03-SEP-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ASP0581
 - locus tag: ASP0581_08710 [new locus tag: EL334_RS04630 ]
 - pan locus tag?: PNEUPAN001909000
 - symbol: lspA
 - pan gene symbol?: lspA
 - synonym:
 - product: lipoprotein signal peptidase
 
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
 - locus tag: ASP0581_08710 [new locus tag: EL334_RS04630 ]
 - symbol: lspA
 - product: lipoprotein signal peptidase
 - replicon: chromosome
 - strand: +
 - coordinates: 870263..870724
 - length: 462
 - essential: unknown
 
⊟Accession numbers[edit | edit source]
- Location: AP019192 (870263..870724) NCBI
 - BioCyc: see EL334_RS04630
 - MicrobesOnline:
 - PneumoBrowse for strain D39V: SPV_0819 PneumoBrowse
 
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAAAAAGAGCAATAGTGGCAGTCATTGTACTGCTTTTAATTGGGCTGGATCAGTTG
GTCAAATCCTATATCGTCCAGCAGATTCCACTGGGTGAAGTGCGCTCCTGGATTCCCAAT
TTCGTTAGCTTGACCTACCTGCAAAATCGAGGTGCAGCCTTTTCTATCTTACAAGATCAG
CAGCTGTTATTCGCTGTCATTACTCTGGTTGTCGTGATAGGTGCCATTTGGTATTTACAT
AAACACATGGAGGACTCATTCTGGATGGTCTTGGGTTTGACTCTAATAATCGCGGGTGGT
CTTGGAAACTTTATTGACAGGGTCAGTCAGGGCTTTGTTGTGGATATGTTCCACCTTGAC
TTTATCAACTTTGCAATTTTCAATGTGGCAGATAGCTATCTGACGGTTGGAGTGATTATT
TTATTGATTGCAATGCTAAAAGAGGAAATAAATGGAAATTAA60
120
180
240
300
360
420
462 
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ASP0581_08710 [new locus tag: EL334_RS04630 ]
 - symbol: LspA
 - description: lipoprotein signal peptidase
 - length: 153
 - theoretical pI: 6.23647
 - theoretical MW: 17150.3
 - GRAVY: 0.903268
 
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking signal peptidase II (TIGR00077; EC 3.4.23.36; HMM-score: 121.9)and 1 moreCell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 5.1)
 - TheSEED: data available for D39, Hungary19A-6, TIGR4
 - PFAM: no clan defined Peptidase_A8; Signal peptidase (SPase) II (PF01252; HMM-score: 128.5)and 4 moreDUF6594; Family of unknown function (DUF6594) (PF20237; HMM-score: 11.7)MFS (CL0015) OATP; Organic Anion Transporter Polypeptide (OATP) family (PF03137; HMM-score: 11.2)no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 8.7)TMEM_230_134; Transmembrane proteins 230/134 (PF05915; HMM-score: 8.3)
 
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
 - modifications:
 - cofactors:
 - effectors:
 
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
 - Cytoplasmic Membrane Score: 10
 - Cellwall Score: 0
 - Extracellular Score: 0
 - Internal Helices: 4
 
 - DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
 - Cytoplasmic Membrane Score: 0.9985
 - Cell wall & surface Score: 0
 - Extracellular Score: 0.0014
 
 - SignalP: Signal peptide SP(Sec/SPI) length 23 aa
- SP(Sec/SPI): 0.501891
 - TAT(Tat/SPI): 0.000482
 - LIPO(Sec/SPII): 0.044322
 - Cleavage Site: CS pos: 23-24. VKS-YI. Pr: 0.4361
 
 - predicted transmembrane helices (TMHMM): 4
 
⊟Accession numbers[edit | edit source]
- GI:
 - RefSeq: BBG81393 NCBI
 - UniProt:
 
⊟Protein sequence[edit | edit source]
- MKKRAIVAVIVLLLIGLDQLVKSYIVQQIPLGEVRSWIPNFVSLTYLQNRGAAFSILQDQQLLFAVITLVVVIGAIWYLHKHMEDSFWMVLGLTLIIAGGLGNFIDRVSQGFVVDMFHLDFINFAIFNVADSYLTVGVIILLIAMLKEEINGN
 
⊟Experimental data[edit | edit source]
- protein localization:
 - interaction partners:
 
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
 
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0819 PneumoExpress
 
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Suneeta Khandavilli, Karen A Homer, Jose Yuste, Shilpa Basavanna, Timothy Mitchell, Jeremy S Brown  
Maturation of Streptococcus pneumoniae lipoproteins by a type II signal peptidase is required for ABC transporter function and full virulence. 
Mol Microbiol: 2008, 67(3);541-57 
[PubMed:18086214]  [WorldCat.org] [DOI] (P p)