Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NU83127
- locus tag: EL277_RS10565 [old locus tag: SPNU_1997 ]
- pan locus tag?: PNEUPAN003685000
- symbol: comGC
- pan gene symbol?: comGC
- synonym:
- product: comG operon protein ComGC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL277_RS10565 [old locus tag: SPNU_1997 ]
- symbol: comGC
- product: comG operon protein ComGC
- replicon: chromosome
- strand: -
- coordinates: 1972993..1973319
- length: 327
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018936 (1972993..1973319) NCBI
- BioCyc: EL277_RS10565 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1861 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAG
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACC
AAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGC
CAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGGA
GGAGCAAATCGTAAAGTCAATGATTAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL277_RS10565 [old locus tag: SPNU_1997 ]
- symbol: ComGC
- description: comG operon protein ComGC
- length: 108
- theoretical pI: 10.1906
- theoretical MW: 12177.3
- GRAVY: -0.263889
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 33.4)Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 33.4)and 7 moreCell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 25)Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 22.6)Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 20.2)Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 18.3)Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 18.3)type II secretion system protein I (TIGR01707; HMM-score: 13.2)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 27.4)and 6 moreNusG_II; NusG domain II (PF07009; HMM-score: 15)DUF4330; Domain of unknown function (DUF4330) (PF14221; HMM-score: 14.5)SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 14.3)DUF1980; Domain of unknown function (DUF1980) (PF09323; HMM-score: 14)Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 11.6)Omega_toxin (CL0083) Conotoxin; Conotoxin (PF02950; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0236
- Cytoplasmic Membrane Score: 0.8196
- Cell wall & surface Score: 0.0266
- Extracellular Score: 0.1302
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.109723
- TAT(Tat/SPI): 0.000606
- LIPO(Sec/SPII): 0.005485
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000738627 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQADGRITEEQAKAYKEYNDKNGGANRKVND
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1861 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.