Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 14-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ASP0581
- locus tag: EL334_RS05895 [old locus tag: ASP0581_11020 ]
- pan locus tag?: PNEUPAN000519000
- symbol: EL334_RS05895
- pan gene symbol?: —
- synonym:
- product: DUF5945 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL334_RS05895 [old locus tag: ASP0581_11020 ]
- symbol: EL334_RS05895
- product: DUF5945 family protein
- replicon: chromosome
- strand: +
- coordinates: 1105701..1106084
- length: 384
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACAAAAGATTGGAATTTTAATCAACCATTAGAAAGTAAATCAGAAAATCAAGAAGAT
CCAGATAAAATTGCGGCCTTATTTGGAAATCATCAAGGAGGTAATGATGTAAATTATGAA
GCAGCTTTTCAAAAGCGAAAACAAGCACCTGTGACGGAATCAAATCCTAGTTCTAAATCC
AAAGTTACAGAGGTTAGAACAGGAAAAGAGACAGATATCACTACAAGTTATCAGCAACAT
CTTAAAAGACTGATTGCAGATAACAATAGCGATATTCAAAGTAGTCAAAAGAAAATTGAA
GAGCTACATACGTTGATTGACACAAAGAATAAAGACAATAAGAAATTGCAGTCCATTTAT
GATGCGATTTCCGAATTACACTAA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL334_RS05895 [old locus tag: ASP0581_11020 ]
- symbol: EL334_RS05895
- description: DUF5945 family protein
- length: 127
- theoretical pI: 6.52286
- theoretical MW: 14460.8
- GRAVY: -1.18819
⊟Function[edit | edit source]
- TIGRFAM: two transmembrane protein (TIGR04527; HMM-score: 11.2)
- TheSEED: data available for Hungary19A-6
- PFAM: no clan defined DUF5945; Family of unknown function (DUF5945) (PF19370; HMM-score: 101.9)and 7 moreFliD_C; Flagellar hook-associated protein 2 C-terminus (PF07195; HMM-score: 15.9)DUF5082; Domain of unknown function (DUF5082) (PF16888; HMM-score: 15.2)Cep57_CLD_2; Centrosome localisation domain of PPC89 (PF14197; HMM-score: 14.8)Cor1; Cor1/Xlr/Xmr conserved region (PF04803; HMM-score: 14.6)GAG-polyprotein (CL0523) DUF1759; Protein of unknown function (DUF1759) (PF03564; HMM-score: 14.2)no clan defined Sec2p; GDP/GTP exchange factor Sec2p (PF06428; HMM-score: 12.9)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8042
- Cytoplasmic Membrane Score: 0.0117
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.1825
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.014061
- TAT(Tat/SPI): 0.003976
- LIPO(Sec/SPII): 0.003132
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000159213 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTKDWNFNQPLESKSENQEDPDKIAALFGNHQGGNDVNYEAAFQKRKQAPVTESNPSSKSKVTEVRTGKETDITTSYQQHLKRLIADNNSDIQSSQKKIEELHTLIDTKNKDNKKLQSIYDAISELH
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]