Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 12-MAY-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 6A-10
- locus tag: HKM25_1749 [new locus tag: HKM25_RS08560 ]
- pan locus tag?: PNEUPAN003137000
- symbol: HKM25_1749
- pan gene symbol?: gntR
- synonym:
- product: winged helix-turn-helix DNA-binding family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HKM25_1749 [new locus tag: HKM25_RS08560 ]
- symbol: HKM25_1749
- product: winged helix-turn-helix DNA-binding family protein
- replicon: chromosome
- strand: +
- coordinates: 1677090..1677410
- length: 321
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP053210 (1677090..1677410) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1524 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGAGAAAATCAAGCTTCAGATTGTTTCCCATACACTGGAACCCAATCAACAACTTCCA
ACCGTGAGGGAGCTAGCTAGCGAGGCTGGTGTCAATCCCAATACCATCCAAAGAGCCTTA
TCAGACCTTGAACGAGAAGGATTTGTCTACAGCAAGCGAACAACTGGACGATTTGTGACT
AAGGATAAGGAGCTAATCGCCCAGTCACGCAAACAATTATCAGAAGAAGAATTGGAACAC
TTCGTTTCCTCCATGACCCATTTTGGCTATGAAAAAGAAGAACTACCAGGCGTAGTCAGT
GATTATATTAAAGGAGTTTAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HKM25_1749 [new locus tag: HKM25_RS08560 ]
- symbol: HKM25_1749
- description: winged helix-turn-helix DNA-binding family protein
- length: 106
- theoretical pI: 5.69176
- theoretical MW: 12092.6
- GRAVY: -0.595283
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 34.3)Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 33.2)Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 33.2)Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 32.2)Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 32.2)and 11 moreRegulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 25.6)DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 21.5)Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 21.5)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 21.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.9)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.9)Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 14.1)Regulatory functions DNA interactions beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family (TIGR02431; HMM-score: 13.6)Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 13.3)Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 13.3)Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 13.3)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 54.7)and 29 moreRrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 25.7)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 24.9)LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 24.3)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 23.6)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 23.3)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 22.8)MarR; MarR family (PF01047; HMM-score: 22.2)MarR_2; MarR family (PF12802; HMM-score: 21.7)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.3)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 20.1)HTH_11; HTH domain (PF08279; HMM-score: 19.1)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 18.8)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 17.8)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 17.2)HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 16.9)DUF6432; Family of unknown function (DUF6432) (PF20024; HMM-score: 16.8)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.1)HTH_Tnp_1; Transposase (PF01527; HMM-score: 15.6)RepL; Firmicute plasmid replication protein (RepL) (PF05732; HMM-score: 15.5)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.4)HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 15.3)HTH_54; ParA helix turn helix domain (PF18607; HMM-score: 15.2)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.6)no clan defined GPAT_C; Glycerol-3-phosphate acyltransferase C-terminal region (PF19277; HMM-score: 12.8)HTH (CL0123) HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.6)TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 12.5)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 12.3)Ribosomal_S19e; Ribosomal protein S19e (PF01090; HMM-score: 12)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.993
- Cytoplasmic Membrane Score: 0.0029
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0036
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007519
- TAT(Tat/SPI): 0.000528
- LIPO(Sec/SPII): 0.000528
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QJS37454 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEKIKLQIVSHTLEPNQQLPTVRELASEAGVNPNTIQRALSDLEREGFVYSKRTTGRFVTKDKELIAQSRKQLSEEELEHFVSSMTHFGYEKEELPGVVSDYIKGV
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1524 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]