Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 6A-10
- locus tag: HKM25_RS10020 [old locus tag: HKM25_2053 ]
- pan locus tag?: PNEUPAN001881000
- symbol: HKM25_RS10020
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HKM25_RS10020 [old locus tag: HKM25_2053 ]
- symbol: HKM25_RS10020
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1959260..1959643
- length: 384
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP053210 (1959260..1959643) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAATACCATAGAGCGGACTAGGCGGCTGGTTAAAGGCTGCGCAACACACTGTTTTGAG
GTTGTAGATAGAACTGACGAAGTCAGCTCAAAGCATGTTTTTGAGGTTGCAGATGAAACT
GACGAAGTCAGCTCAAAACATGTTTTTGAGGTTGTGGATGAAACTGACGAAGTCAGCTCA
AAACATGTTTTTGAGGTTGTGGATGAAACTGACGAAGTCAGCTCAAAACATGTTTTTGAG
GTTGTGGATGAAACTGACGAAGTCAGCTCAAAACATGTTTTTGAGGTTGTGGATGAAACT
GACGAAGTCAGCTCAAAACATGTTTTTGAGGTTGTGGATGAAACTGACGAAGTCAGTAAC
CATACATACGGTAAGGCGACGTGA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HKM25_RS10020 [old locus tag: HKM25_2053 ]
- symbol: HKM25_RS10020
- description: hypothetical protein
- length: 127
- theoretical pI: 4.15598
- theoretical MW: 14422.5
- GRAVY: -0.56378
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General ROK family protein (putative glucokinase) (TIGR00744; HMM-score: 21)and 3 moreTransport and binding proteins Anions phosphate transport system regulatory protein PhoU (TIGR02135; HMM-score: 11.9)Regulatory functions Other phosphate transport system regulatory protein PhoU (TIGR02135; HMM-score: 11.9)EXLDI protein (TIGR04342; HMM-score: 10.3)
- TheSEED:
- PFAM: no clan defined Ribosomal_L11; Ribosomal protein L11, RNA binding domain (PF00298; HMM-score: 15.8)HTH (CL0123) YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 15.6)no clan defined DUF1810; Protein of unknown function (DUF1810) (PF08837; HMM-score: 15.2)TPR (CL0020) DUF5071; Domain of unknown function (DUF5071) (PF16804; HMM-score: 13.8)HTH (CL0123) DUF3895; Protein of unknown function (DUF3895) (PF13034; HMM-score: 12.8)and 7 morePhage_TACs (CL0567) Phage_TAC_8; Phage tail assembly chaperone protein Gp14 ()A118 (PF10666; HMM-score: 11.7)no clan defined CMV_1a_C; Cucumber mosaic virus 1a protein C terminal (PF12503; HMM-score: 10.7)PH (CL0266) PH; PH domain (PF00169; HMM-score: 9.9)PDZ-like (CL0466) PDZ_4; PDZ domain (PF17816; HMM-score: 9.7)no clan defined DUF3638; Protein of unknown function (DUF3638) (PF12340; HMM-score: 7.6)PDDEXK (CL0236) tRNA_int_endo; tRNA intron endonuclease, catalytic C-terminal domain (PF01974; HMM-score: 7.3)no clan defined Orthopox_F6; Orthopoxvirus F6 protein (PF06601; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4391
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0034
- Extracellular Score: 0.5571
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006271
- TAT(Tat/SPI): 0.002139
- LIPO(Sec/SPII): 0.00107
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001092044 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTIERTRRLVKGCATHCFEVVDRTDEVSSKHVFEVADETDEVSSKHVFEVVDETDEVSSKHVFEVVDETDEVSSKHVFEVVDETDEVSSKHVFEVVDETDEVSSKHVFEVVDETDEVSNHTYGKAT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]