Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 28-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_10042 [new locus tag: HMPREF0837_RS00225 ]
- pan locus tag?: PNEUPAN003679000
- symbol: HMPREF0837_10042
- pan gene symbol?: —
- synonym:
- product: methyltransferase domain protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_10042 [new locus tag: HMPREF0837_RS00225 ]
- symbol: HMPREF0837_10042
- product: methyltransferase domain protein
- replicon: chromosome
- strand: -
- coordinates: 36488..37075
- length: 588
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: CP001993 (36488..37075) NCBI
- BioCyc: see HMPREF0837_RS00225
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2427 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAACATGATTTTAACCACAAAGCAGAAACTTTCGATTCCCCTAAAAATATCTTCCTC
GCAAACTTGGTATGTCAAGCAGTCGAGAAACAGATTGATATTTTATCAGACAAAGAAATT
TTAGATTTCGGTGGTGGCACGGGTCTATTAGCCTTGCCCCTAGCCAAGCAGGCTAAGTCA
GTTACTCTTGTAGACATTTCTGAGAAAATGTTGGAGCAAGCTCGTTTGAAAGCGGAGCAG
CAAGCAATCAAGAATATCCAGTTTTTGGAGCAAGATTTACCGAAAAATCCCTTGGAGAAA
GAGTTTGATTGCCTTGCTGTTAGTCGGGTTCTTCATCATATGCCTGATTTGGATGCGGCT
CTCTCACTGTTTCATCAACATTTGAAGGAAGATGGGAAACTCATCATTGCTGATTTTACC
AAGACAGAAGCTAATCATCATGGATTTGATTTAGCTGAACTGGAAAACAAGCTAATTGAG
CATGGTTTTTCATCTGTGAATAGTCAGATTCTCTATAGCGCTGAAGACCTGTTTCAAGGA
AATTACTCAGAATTCTTTTTAATAGTAGCCCAAAAATCACTCGCCTAG60
120
180
240
300
360
420
480
540
588
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_10042 [new locus tag: HMPREF0837_RS00225 ]
- symbol: HMPREF0837_10042
- description: methyltransferase domain protein
- length: 195
- theoretical pI: 5.09478
- theoretical MW: 21915.9
- GRAVY: -0.184615
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 70.6)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 65.9)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 59.5)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 52.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 40.6)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 35.8)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 33.8)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 32.7)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 32.3)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 31)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 30.3)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 30.2)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 26.5)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 26.4)Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 24.8)Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 24)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 22.2)Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 21.6)Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 21.6)putative methyltransferase, LIC12133 family (TIGR04325; EC 2.1.1.-; HMM-score: 21)Protein synthesis tRNA and rRNA base modification tRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 17.3)Cellular processes Toxin production and resistance tellurite resistance protein TehB (TIGR00477; HMM-score: 13.8)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 12.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 12.4)Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 12.3)methyltransferase, FxLD system (TIGR04364; HMM-score: 10.7)
- TheSEED :
- Methylase involved in ubiquinone/menaquinone biosynthesis
- PFAM: NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 70.6)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 70.4)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 67.9)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 65.2)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 63.8)and 24 moreUbie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 55.6)MTS; Methyltransferase small domain (PF05175; HMM-score: 45.4)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 32.1)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 30.8)Methyltransf_2; O-methyltransferase domain (PF00891; HMM-score: 30.6)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 26)GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 24.4)Methyltransf_PK; AdoMet dependent proline di-methyltransferase (PF05891; HMM-score: 21.1)Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 20.8)Methyltransf_16; Lysine methyltransferase (PF10294; HMM-score: 20.3)TehB; Tellurite resistance protein TehB (PF03848; HMM-score: 20.2)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 18.6)Methyltransf_9; Protein of unknown function (DUF1698) (PF08003; HMM-score: 18)BpsA_C; Branched-chain polyamine synthase A C-terminal domain (PF01861; HMM-score: 16.6)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 16.4)tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 16.4)CheR; CheR methyltransferase, SAM binding domain (PF01739; HMM-score: 15.3)NNMT_PNMT_TEMT; NNMT/PNMT/TEMT family (PF01234; HMM-score: 14.5)Bmt2; 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2 (PF11968; HMM-score: 14.5)Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 14.3)Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 14.1)PDDEXK (CL0236) RE_TaqI; TaqI restriction endonuclease (PF09573; HMM-score: 13.5)NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 12.1)DREV; DREV methyltransferase (PF05219; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9923
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0067
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010063
- TAT(Tat/SPI): 0.005647
- LIPO(Sec/SPII): 0.001574
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADI68270 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHDFNHKAETFDSPKNIFLANLVCQAVEKQIDILSDKEILDFGGGTGLLALPLAKQAKSVTLVDISEKMLEQARLKAEQQAIKNIQFLEQDLPKNPLEKEFDCLAVSRVLHHMPDLDAALSLFHQHLKEDGKLIIADFTKTEANHHGFDLAELENKLIEHGFSSVNSQILYSAEDLFQGNYSEFFLIVAQKSLA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2427 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]