Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_RS01425 [old locus tag: HMPREF0837_10282 ]
- pan locus tag?: PNEUPAN000017000
- symbol: HMPREF0837_RS01425
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_RS01425 [old locus tag: HMPREF0837_10282 ]
- symbol: HMPREF0837_RS01425
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 259852..260043
- length: 192
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGCGTCTTACATTGAAAGCGTTGCGGGCTAATAGCAACATGAAACAATCAGAGGTAGCA
CAAAAATTAGGAATTTCTACAACTACTTGGAGTAAGTGGGAAAATGGAAAAAGTTTTCCT
GATGTTGCCCAAGTAAAAGAGATTGAAAAACTTTTCGGTGTTGCTTATGACGACATTATT
TTTTTAAGCTAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_RS01425 [old locus tag: HMPREF0837_10282 ]
- symbol: HMPREF0837_RS01425
- description: helix-turn-helix transcriptional regulator
- length: 63
- theoretical pI: 9.84174
- theoretical MW: 7134.19
- GRAVY: -0.261905
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 26.9)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 26.8)and 7 moreHypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 14.1)probable regulatory domain (TIGR03879; HMM-score: 13.8)EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 13)Amino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 12.9)Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 12.9)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 12.7)RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 11.9)
- TheSEED: see HMPREF0837_10282
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 46.8)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 42.1)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 37.8)and 24 moreHTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 23.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 22.9)DUF1870; Domain of unknown function (DUF1870) (PF08965; HMM-score: 19.2)no clan defined RWP-RK; RWP-RK domain (PF02042; HMM-score: 18.7)HTH (CL0123) MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 18.3)HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 17.2)YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 16.5)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 16)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 14.8)no clan defined DUF5997; Family of unknown function (DUF5997) (PF19460; HMM-score: 14.6)HTH (CL0123) Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 14.4)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 13.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.5)P22_Cro; DNA-binding transcriptional regulator Cro (PF14549; HMM-score: 13.2)Trp_repressor; Trp repressor protein (PF01371; HMM-score: 12.9)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 12.9)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.8)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.8)BetR; BetR domain (PF08667; HMM-score: 12.7)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 11.8)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 11.7)HTH_11; HTH domain (PF08279; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6278
- Cytoplasmic Membrane Score: 0.218
- Cell wall & surface Score: 0.0025
- Extracellular Score: 0.1517
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025137
- TAT(Tat/SPI): 0.001884
- LIPO(Sec/SPII): 0.006516
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001241280 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRLTLKALRANSNMKQSEVAQKLGISTTTWSKWENGKSFPDVAQVKEIEKLFGVAYDDIIFLS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]