Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 22-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae gamPNI0373
- locus tag: HMPREF1038_RS08300 [old locus tag: HMPREF1038_01693 ]
- pan locus tag?: PNEUPAN003136000
- symbol: nrdR
- pan gene symbol?: nrdR
- synonym:
- product: transcriptional regulator NrdR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF1038_RS08300 [old locus tag: HMPREF1038_01693 ]
- symbol: nrdR
- product: transcriptional regulator NrdR
- replicon: chromosome
- strand: -
- coordinates: 1562407..1562880
- length: 474
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_018630 (1562407..1562880) NCBI
- BioCyc: HMPREF1038_RS08300 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1523 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCGTTGTCCAAAATGTGGGGCTACCAAGTCAAGTGTTATCGATAGTCGCCAAGCAGAA
GAAGGGAACACCATTCGTAGAAGACGTGAGTGCGACGAATGCCAACACCGTTTTACAACC
TACGAACGAGTAGAAGAAAGAACCTTAGTGGTTGTTAAAAAAGATGGTACACGGGAACAA
TTCTCCAGAGATAAAATCTTTAATGGGATTATCCGCTCAGCCCAGAAACGTCCTGTGTCA
AGTGATGAAATCAACATGGTAGTCAATCGTATCGAACAGAAACTCCGTGGTCGAAATGAA
AATGAAATTCAAAGTGAGGACATTGGTTCACTCGTCATGGAGGAGTTGGCTGAATTGGAC
GAGATTACCTATGTACGTTTTGCTAGTGTCTATCGTAGTTTTAAGGATGTCAGTGAGTTA
GAGAGCTTGCTCCAACAAATCACCCAGTCCTCTAAAAAGAAAAAGGAAAGATAA60
120
180
240
300
360
420
474
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF1038_RS08300 [old locus tag: HMPREF1038_01693 ]
- symbol: NrdR
- description: transcriptional regulator NrdR
- length: 157
- theoretical pI: 8.63375
- theoretical MW: 18379.6
- GRAVY: -0.917834
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 190.3)and 4 moreMobile and extrachromosomal element functions Prophage functions restriction alleviation protein, Lar family (TIGR03655; HMM-score: 16.3)DNA metabolism Restriction/modification restriction alleviation protein, Lar family (TIGR03655; HMM-score: 16.3)Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 15.3)Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 13.3)
- TheSEED: see HMPREF1038_01693
- PFAM: no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 73.6)and 9 moreZn_Beta_Ribbon (CL0167) TFIIS_C; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 20.8)Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 19.2)POTRA (CL0191) POTRA_2; POTRA domain, ShlB-type (PF08479; HMM-score: 13.9)Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 13.7)zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 12.9)TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 11.9)Ogr_Delta; Ogr/Delta-like zinc finger (PF04606; HMM-score: 9.3)zinc_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 8.8)UPF0547; Uncharacterised protein family UPF0547 (PF10571; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9518
- Cytoplasmic Membrane Score: 0.0069
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.041
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021569
- TAT(Tat/SPI): 0.001095
- LIPO(Sec/SPII): 0.006615
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001203672 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRCPKCGATKSSVIDSRQAEEGNTIRRRRECDECQHRFTTYERVEERTLVVVKKDGTREQFSRDKIFNGIIRSAQKRPVSSDEINMVVNRIEQKLRGRNENEIQSEDIGSLVMEELAELDEITYVRFASVYRSFKDVSELESLLQQITQSSKKKKER
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1523 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]