Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-OCT-2023
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BVJ1JL
- locus tag: JN057_00163 [new locus tag: JN057_RS00810 ]
- pan locus tag?: PNEUPAN000758000
- symbol: JN057_00163
- pan gene symbol?: scaA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JN057_00163 [new locus tag: JN057_RS00810 ]
- symbol: JN057_00163
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 139096..139380
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP071871 (139096..139380) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0106 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGAAAATTAGTTAAAATTGGTGTTGCATCTTTAATGGTATGTAGTATACTTGCTTCT
ACAAGTGTTTTGGCAGTATGGGTTGATGGTGGTCAATGGAACTATGGAGTAGGATGGTCA
GGAAATTTTGGTTATTCTGATTATTTACATTCTACTCGCTCTCATACAGCAACTGTTAAA
GATGGAAATAAATTCTCTAAGGATCGTGCAGAAGCTGAGGCATGGGCTCGGGCTTCAATC
TTCAAATTCCCACCAACGGGAATGGAATATTTCTATGGATTTTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JN057_00163 [new locus tag: JN057_RS00810 ]
- symbol: JN057_00163
- description: hypothetical protein
- length: 94
- theoretical pI: 9.46872
- theoretical MW: 10423.8
- GRAVY: -0.0829787
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 76.1)and 1 moreprobable ammonium transporter, marine subtype (TIGR03644; HMM-score: 11.7)
- TheSEED: data available for D39, Hungary19A-6
- PFAM: no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 83.5)and 1 moreLolA_LolB (CL0048) LolA_2; Outer membrane lipoprotein carrier protein LolA (PF16584; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.9999
- SignalP: Signal peptide SP(Sec/SPI) length 25 aa
- SP(Sec/SPI): 0.976158
- TAT(Tat/SPI): 0.001025
- LIPO(Sec/SPII): 0.012725
- Cleavage Site: CS pos: 25-26. VLA-VW. Pr: 0.8764
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: QTE31828 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRKLVKIGVASLMVCSILASTSVLAVWVDGGQWNYGVGWSGNFGYSDYLHSTRSHTATVKDGNKFSKDRAEAEAWARASIFKFPPTGMEYFYGF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0106 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]