From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 08-APR-2025

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae BVJ1JL
  • locus tag: JN057_RS11825
  • pan locus tag?: PNEUPAN003521000
  • symbol: JN057_RS11825
  • pan gene symbol?:
  • synonym:
  • product: ABC transporter ATP-binding protein/permease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JN057_RS11825
  • symbol: JN057_RS11825
  • product: ABC transporter ATP-binding protein/permease
  • replicon: chromosome
  • strand: -
  • coordinates: 1809006..1809977
  • length: 972
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NZ_CP071871 (1809006..1809977) NCBI
  • BioCyc:
  • MicrobesOnline:
  • PneumoBrowse for strain D39V:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGGACTTCCTTCTCATGGGAGCACTCTTCATCGTTCTTCCCCGAACTATGGTCTCTGCT
    AAGCGGATTAATCAAGTTTTAGATTTGCATTCTTCTATCCAAAACCCTGCTCAAGTGCAG
    CTGACTGATGAAAACTTCAAAGGTCAGGTCGAGTTTAAGGATGTGACCTTCCGCTATGCG
    GCAAATTCGGAGGCAGTTATTGAACATGTTAGCTTTAAAGCAGAAACTGGTCAAACAGTG
    GCCTTTATTGGGTCAATAGGTTCTGGTAAATCAACTCTGGTCAATCTGATTCCACGTTTC
    TACGACGTGTCAGCAGGAGAAATTCTGGTGGACGGTGTCAATGTTCAAGACTATGACTTC
    TCTGCGACAGCTCATGCTGGTCAAAGGGTTGCCATTGTTGGGCCGACTGGGGCTGGTAAG
    ACAACCATTGTCAATCTTTTGATGAAATTCTATGAGATTGATAAGGGAAGTATTCGCATT
    GATGGTGTGGATACCAAGGCTATGACGCGTTCAGAAGTGCATGATGCCTTTTCAATGGTC
    TTGCAGGATACCTGGCTCTTTGAAGGAACTATTCGAGACAATCTCATCTATAATCAAATA
    GGGATTAGTGATGAACGAATGATGGAAGCTAGTAAGGCTGTGGGAATTCACCACTTTATT
    ATGACCTTGCCAGATGGCTATGATACCATCTTGGATGACACCGTGACCTTGTCTGTAGGA
    CAAAAACAACTATTGACTATTGCTCGTGCCCTTCTTAAGGATGCACCGCTTTTGATTTTG
    GATGAGGCGACTTCTTCTGTTGACACACGGACAGAGGAATTGATCCAAAAAGCCATGGAC
    CGTTTGATGGAAGGACGCACATCCTTTGTCATTGCCCACCGCTTGTCAACCATCCGAAAT
    GCAGACTTGATCTTGGTCATGAAAGATGGAAATATCATCGAGCAAGGCAACTATGAGGAA
    CTGATGGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    972

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JN057_RS11825
  • symbol: JN057_RS11825
  • description: ABC transporter ATP-binding protein/permease
  • length: 323
  • theoretical pI: 4.69984
  • theoretical MW: 35709.7
  • GRAVY: 0.0585139

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 331.4)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 331.4)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 321)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 284.8)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 284.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 284.6)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 273.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 268.4)
    and 99 more
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 260.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 260.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 244.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 244.9)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 229.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 215.5)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 215.5)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 215.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 212.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 195.5)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 164.1)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 144.3)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 136.1)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 128.3)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.8)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 120.8)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 120.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 119.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 115)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 109.4)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 108.5)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 103.4)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 94.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 94.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 93.9)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 93.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 93.1)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 93.1)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 93)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 92.9)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 92.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 92.3)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 87.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 85.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 85)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 83.9)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 83.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 83.1)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 82.3)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 81.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 79.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 79.3)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 79.3)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 77.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 75.7)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 74.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 73.1)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72.4)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 72.4)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 69.2)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 69.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.7)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 66.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 62.8)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 59.1)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 57.7)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 47.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 47.2)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 43.3)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 33.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 25.2)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 24.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 23)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 22.7)
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 22)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 21.7)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 21.5)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 20.2)
    Metabolism Energy metabolism Amino acids and amines ethanolamine utilization protein, EutP (TIGR02528; HMM-score: 20)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 19.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 18.3)
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 17.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.9)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.9)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 17.9)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 17.8)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 17.5)
    Genetic information processing Protein fate Protein modification and repair hydrogenase accessory protein HypB (TIGR00073; HMM-score: 17.4)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.3)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 16.6)
    Cellular processes Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 16.1)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 15.5)
    Cellular processes Cellular processes Pathogenesis type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 15.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 15.1)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 14.7)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 14.7)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.2)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 14)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 13.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions adenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 13.5)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 13.3)
    Cellular processes Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 13)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 12.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking putative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 12.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 12.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 12)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 11.7)
  • TheSEED: data available for D39, Hungary19A-6, TIGR4
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 146)
    and 62 more
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 37.9)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.6)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 32.4)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 31)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 29.7)
    AAA_22; AAA domain (PF13401; HMM-score: 29.3)
    AAA_30; AAA domain (PF13604; HMM-score: 28.3)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 27.7)
    AAA_24; AAA domain (PF13479; HMM-score: 27.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 25.2)
    AAA_23; AAA domain (PF13476; HMM-score: 25.1)
    AAA_18; AAA domain (PF13238; HMM-score: 24.9)
    NTPase_1; NTPase (PF03266; HMM-score: 23.9)
    AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 23.3)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23.3)
    AAA_33; AAA domain (PF13671; HMM-score: 22.9)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 22.7)
    AAA_19; AAA domain (PF13245; HMM-score: 22.7)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 22)
    dNK; Deoxynucleoside kinase (PF01712; HMM-score: 21.8)
    AAA_10; AAA-like domain (PF12846; HMM-score: 21.8)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 21.3)
    AAA_28; AAA domain (PF13521; HMM-score: 20.9)
    DUF87; Helicase HerA, central domain (PF01935; HMM-score: 20.2)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 19.7)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 19.7)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 19.5)
    DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 19.5)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 19)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 18.5)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 18.3)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 18.3)
    AAA_14; AAA domain (PF13173; HMM-score: 17.9)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 17.3)
    NACHT; NACHT domain (PF05729; HMM-score: 17)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 17)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 16.9)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 16.6)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 16.6)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 16.3)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 16)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 15.6)
    FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 15.4)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 15.2)
    P-loop_TraG; TraG P-loop domain (PF19044; HMM-score: 15.2)
    AAA_17; AAA domain (PF13207; HMM-score: 15.1)
    Septin; Septin (PF00735; HMM-score: 14.3)
    no clan defined VP1_VP3; Structural protein VP1/VP3 (PF06281; HMM-score: 14.1)
    P-loop_NTPase (CL0023) G-alpha; G-protein alpha subunit (PF00503; HMM-score: 14)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 13.9)
    TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 13.9)
    AAA_25; AAA domain (PF13481; HMM-score: 13.5)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 13.3)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.2)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 13.2)
    CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 12.7)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 12.6)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 12.4)
    SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 12.2)
    Pentapeptide (CL0505) Pentapeptide_4; Pentapeptide repeats (9 copies) (PF13599; HMM-score: 12.2)
    P-loop_NTPase (CL0023) KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 12)
    DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 11)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.04
    • Cytoplasmic Membrane Score: 9.96
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.331463
    • TAT(Tat/SPI): 0.006844
    • LIPO(Sec/SPII): 0.031983
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000346794 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MDFLLMGALFIVLPRTMVSAKRINQVLDLHSSIQNPAQVQLTDENFKGQVEFKDVTFRYAANSEAVIEHVSFKAETGQTVAFIGSIGSGKSTLVNLIPRFYDVSAGEILVDGVNVQDYDFSATAHAGQRVAIVGPTGAGKTTIVNLLMKFYEIDKGSIRIDGVDTKAMTRSEVHDAFSMVLQDTWLFEGTIRDNLIYNQIGISDERMMEASKAVGIHHFIMTLPDGYDTILDDTVTLSVGQKQLLTIARALLKDAPLLILDEATSSVDTRTEELIQKAMDRLMEGRTSFVIAHRLSTIRNADLILVMKDGNIIEQGNYEELMV

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Expression data[edit | edit source]

  • PneumoExpress for strain D39V:

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]