Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae MDRSPN001
- locus tag: MDRSPN_RS10840 [old locus tag: MDRSPN_01530 ]
- pan locus tag?: PNEUPAN001385000
- symbol: MDRSPN_RS10840
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: MDRSPN_RS10840 [old locus tag: MDRSPN_01530 ]
- symbol: MDRSPN_RS10840
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1545116..1545499
- length: 384
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018391 (1545116..1545499) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGCTCAAAGCAGTGTTTGAGGTTATAGATAAGACTGACGAAGTCAGCTTAAAACACTGT
TTTGAGGTTGCAGATAGAACTGATGAAGTCAGCTTAAAACACTGTTTTGAGGTTGTAGAT
GAAACTGACGAAGTCAGCTTAAAACACTGTTTTGAGGTTGCAGATAGAACTGACGAAGTC
AGCTTAAAACACTGTTTTGAGGTTGCAGATAGAACTGACGAAGTCAGCTTAAAACACTGT
TTTGAGGTTGTAGATGAAACTGACGAAGTCAGCTTAAAACACTGTTTTGAGGTTGTAGAT
GAAACTGACGAAGTCAGCTTAAAACACTGTTTTGAGGTTGCAGATAGAACTGACGAAGTC
AGTAACATCTATACGACAAGGTGA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: MDRSPN_RS10840 [old locus tag: MDRSPN_01530 ]
- symbol: MDRSPN_RS10840
- description: hypothetical protein
- length: 127
- theoretical pI: 4.1958
- theoretical MW: 14692.2
- GRAVY: -0.366142
⊟Function[edit | edit source]
- reaction: EC 1.1.1.100? ExPASy3-oxoacyl-[acyl-carrier-protein] reductase (3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP+ = 3-oxoacyl-[acyl-carrier-protein] + NADPH
- TIGRFAM: Unknown function General ROK family protein (putative glucokinase) (TIGR00744; HMM-score: 17.5)
- TheSEED:
- PFAM: no clan defined DNA_ligase_IV; DNA ligase IV (PF11411; HMM-score: 40.6)and 8 moreRibosomal_L11; Ribosomal protein L11, RNA binding domain (PF00298; HMM-score: 31.3)CM2; Influenza C virus M2 protein (PF03021; HMM-score: 18.8)BBS2_C; Ciliary BBSome complex subunit 2, C-terminal (PF14782; HMM-score: 14.8)TBCA; Tubulin binding cofactor A (PF02970; HMM-score: 13.5)Corazonin; Pro-corazonin (PF17308; HMM-score: 13)GCK; GCK domain (PF07802; HMM-score: 11.8)DUF3638; Protein of unknown function (DUF3638) (PF12340; HMM-score: 8.5)SAB; SAB domain (PF04382; HMM-score: 8.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6183
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.3802
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005809
- TAT(Tat/SPI): 0.000173
- LIPO(Sec/SPII): 0.001279
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001816534 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKAVFEVIDKTDEVSLKHCFEVADRTDEVSLKHCFEVVDETDEVSLKHCFEVADRTDEVSLKHCFEVADRTDEVSLKHCFEVVDETDEVSLKHCFEVVDETDEVSLKHCFEVADRTDEVSNIYTTR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]