Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-JUN-2018
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7466
- locus tag: NCTC7466_01485 [new locus tag: DQM66_RS11510 ]
- pan locus tag?: PNEUPAN003049000
- symbol: NCTC7466_01485
- pan gene symbol?: —
- synonym:
- product: Uncharacterised protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NCTC7466_01485 [new locus tag: DQM66_RS11510 ]
- symbol: NCTC7466_01485
- product: Uncharacterised protein
- replicon: chromosome
- strand: +
- coordinates: 1467614..1468006
- length: 393
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: LS483374 (1467614..1468006) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2367 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTGTCCACTCGTTTCACGGGGAAATTAAGCAAATGGGGAAATTACTTTGGTATTGTT
AATACCATTTTGTCCGGTGCTATTGATTATATCCTTGGAAATAAGGCGGCCATCATTACC
TATCCCGTCACCTTCCTCATTTATACCTTTGCTATAAAGAAATGGAAAGCTTCGCAAGAA
GGCAGACCCAACCAAATGAGCCAAAAACAGGTAAAATTGGCGGCCATCATCATTTCCATC
ATCGCCTTCCTCTTTGCCTTTGTGACCAACTATATCGGATATGAGGGCAAGATGAATCTC
CTTGCCTACGTAACAACTATTGCCTTTGCACTGTCCCTCATTGCCAATGCTTTGAATGCA
TTGGCAATGAGGGACAGTGGGGCTTTTGGTTGA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NCTC7466_01485 [new locus tag: DQM66_RS11510 ]
- symbol: NCTC7466_01485
- description: Uncharacterised protein
- length: 130
- theoretical pI: 10.3703
- theoretical MW: 14274.8
- GRAVY: 0.541538
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Pyridine nucleotides nicotinamide mononucleotide transporter PnuC (TIGR01528; HMM-score: 16.3)Transport and binding proteins Other nicotinamide mononucleotide transporter PnuC (TIGR01528; HMM-score: 16.3)
- TheSEED: data available for D39, TIGR4
- PFAM: no clan defined NMN_transporter; Nicotinamide mononucleotide transporter (PF04973; HMM-score: 30.1)and 5 moreDUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 15)DUF373; Domain of unknown function (DUF373) (PF04123; HMM-score: 11.9)DUF1218; Protein of unknown function (DUF1218) (PF06749; HMM-score: 11.9)SLATT (CL0676) DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 10.7)no clan defined Cation_ATPase_C; Cation transporting ATPase, C-terminus (PF00689; HMM-score: 9.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0009
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017773
- TAT(Tat/SPI): 0.001588
- LIPO(Sec/SPII): 0.01026
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: SQG02514 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLSTRFTGKLSKWGNYFGIVNTILSGAIDYILGNKAAIITYPVTFLIYTFAIKKWKASQEGRPNQMSQKQVKLAAIIISIIAFLFAFVTNYIGYEGKMNLLAYVTTIAFALSLIANALNALAMRDSGAFG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2367 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.