Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae BM6001
- locus tag: ODS73_RS10800 [old locus tag: ODS73_10790 ]
- pan locus tag?: PNEUPAN000619000
- symbol: ODS73_RS10800
- pan gene symbol?: —
- synonym:
- product: phage scaffolding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: ODS73_RS10800 [old locus tag: ODS73_10790 ]
- symbol: ODS73_RS10800
- product: phage scaffolding protein
- replicon: chromosome
- strand: -
- coordinates: 2061975..2062538
- length: 564
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP107038 (2061975..2062538) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGCATTTACAACTGAAGAACTACTCAATCTTGGGTTGACAGAAGAACAGGCTAAGTCA
GTCTTTGCTTTGCGAGGAAAAGAGCTGAATGAGGACAAATCAGCCTTAGAAACTATCAAA
CAAGAGCGAGATAGTCTCAAATCACAGTTGCAAAAAGCAGAGGAGCAAGTTGAACACTTG
AAATCACTTGAGAATATCAGCGCTGAACAAAAAGATGCGATTGATAAATTGCAAGCTGAA
TATGACAAGTATAAAAACGAAGCTGCAGCTGAACTTGCACAGACAAAAAAGGTTAGTGCT
ATCAGTCTAGCTCTGAAAGATACAAATGCTTTCAATCCAGACAAATTGATGAAATTCATT
GATGTTGATGCTATCCAGTTAGACGACAACGGGAAACCTCAGATTGATGAAGTAATCAAC
GGTTTAAAAGAAAGTGATCCATATCTGTTCAAAGCTGAAGAAAGTAAGCCTAGCCCCAAT
ATTTTACCTCAAGGTAATCCGGCAGGAGAGGGTACAAGTGATGTTGATCCGTTCCAAGCG
ATTATTGACGGGTATGGCAAATAA60
120
180
240
300
360
420
480
540
564
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: ODS73_RS10800 [old locus tag: ODS73_10790 ]
- symbol: ODS73_RS10800
- description: phage scaffolding protein
- length: 187
- theoretical pI: 4.29171
- theoretical MW: 20684.9
- GRAVY: -0.701604
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.2)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.2)Hypothetical proteins Conserved TIGR02680 family protein (TIGR02680; HMM-score: 13.8)and 9 morePlasmodium yoelii subtelomeric family PYST-B (TIGR01597; HMM-score: 11.5)Protein synthesis tRNA aminoacylation serine--tRNA ligase (TIGR00414; EC 6.1.1.11; HMM-score: 11.3)SH3 domain protein (TIGR04211; HMM-score: 11.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9.8)SEC10/PgrA surface exclusion domain (TIGR04320; HMM-score: 9.6)two transmembrane protein (TIGR04527; HMM-score: 7.2)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 6.9)Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 6.5)
- TheSEED: data available for Hungary19A-6
- PFAM: no clan defined Phage_GP20; Phage minor structural protein GP20 (PF06810; HMM-score: 108.2)and 23 moreGp-FAR-1; Nematode fatty acid retinoid binding protein (Gp-FAR-1) (PF05823; HMM-score: 18.7)Golgin_A5; Golgin subfamily A member 5 (PF09787; HMM-score: 16.9)zf-C4H2; Zinc finger-containing protein (PF10146; HMM-score: 15.6)Med9; RNA polymerase II transcription mediator complex subunit 9 (PF07544; HMM-score: 15)GAS; Growth-arrest specific micro-tubule binding (PF13851; HMM-score: 13.9)LTXXQ-like (CL0515) LTXXQ; LTXXQ motif family protein (PF07813; HMM-score: 13.5)P-loop_NTPase (CL0023) iSTAND; inactive STAND (PF19995; HMM-score: 13.4)no clan defined EcoRI_methylase; Adenine-specific methyltransferase EcoRI (PF13651; HMM-score: 12.8)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 12.4)HXXSHH; Protein of unknown function (DUF1552) (PF07586; HMM-score: 12.1)UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 11.5)TetR_C (CL0174) TetR_C_23; Tetracyclin repressor-like, C-terminal domain (PF17931; HMM-score: 11)Glyoxalase (CL0104) Glyoxalase_8; Glyoxalase superfamily protein (PF20066; HMM-score: 11)BCLiA (CL0551) ATG14; Vacuolar sorting 38 and autophagy-related subunit 14 (PF10186; HMM-score: 10.9)no clan defined FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 10.3)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 9.5)no clan defined TMPIT; TMPIT-like protein (PF07851; HMM-score: 9.4)DUF4252; Domain of unknown function (DUF4252) (PF14060; HMM-score: 9.4)Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 8.9)no clan defined Herpes_UL6; Herpesvirus UL6 like (PF01763; HMM-score: 8.7)GrpE; GrpE (PF01025; HMM-score: 7.5)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 7.4)V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8952
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0341
- Extracellular Score: 0.07
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003334
- TAT(Tat/SPI): 0.000457
- LIPO(Sec/SPII): 0.000567
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000896122 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAFTTEELLNLGLTEEQAKSVFALRGKELNEDKSALETIKQERDSLKSQLQKAEEQVEHLKSLENISAEQKDAIDKLQAEYDKYKNEAAAELAQTKKVSAISLALKDTNAFNPDKLMKFIDVDAIQLDDNGKPQIDEVINGLKESDPYLFKAEESKPSPNILPQGNPAGEGTSDVDPFQAIIDGYGK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.