Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 15-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_RS08915 [old locus tag: SP70585_1795 ]
- pan locus tag?: PNEUPAN003185000
- symbol: SP70585_RS08915
- pan gene symbol?: asp5
- synonym:
- product: accessory Sec system protein Asp5
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_RS08915 [old locus tag: SP70585_1795 ]
- symbol: SP70585_RS08915
- product: accessory Sec system protein Asp5
- replicon: chromosome
- strand: -
- coordinates: 1665597..1665821
- length: 225
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012468 (1665597..1665821) NCBI
- BioCyc: SP70585_RS08915 BioCyc
- MicrobesOnline: see SP70585_1795
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTGACATACTAATTGTTTTAGCTATTATTCTATCTCTTGCTTTGATTGTATTGGTA
ACTATACAACCCCGTCAAAATCAACTATTTTCCATGGATGCCACTAGTAATATTGGTAAA
CCAAGCTACTGGCAGAGCAACACCTTGGTCAAGGTGCTCACTTTATTGGTGAGTTTGGCT
TTATTTGTTCTACTATTAACCTTTATGGTGATTACTTATAAATAA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_RS08915 [old locus tag: SP70585_1795 ]
- symbol: SP70585_RS08915
- description: accessory Sec system protein Asp5
- length: 74
- theoretical pI: 9.86564
- theoretical MW: 8278.1
- GRAVY: 1.24865
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecG subunit (TIGR00810; HMM-score: 17.1)Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 14)and 2 moreTransport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 9.1)Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.3)
- TheSEED: see SP70585_1795
- PFAM: no clan defined Asp5; Accessory secretory protein Sec, Asp5 (PF17000; HMM-score: 100.8)and 3 moreSecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 20.7)Cation_ATPase_C; Cation transporting ATPase, C-terminus (PF00689; HMM-score: 12)MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 8.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9986
- Cell wall & surface Score: 0
- Extracellular Score: 0.0014
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019366
- TAT(Tat/SPI): 0.000483
- LIPO(Sec/SPII): 0.046684
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000565444 NCBI
- UniProt: see SP70585_1795
⊟Protein sequence[edit | edit source]
- MIDILIVLAIILSLALIVLVTIQPRQNQLFSMDATSNIGKPSYWQSNTLVKVLTLLVSLALFVLLLTFMVITYK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP70585_RS14020 < SP70585_RS08915 < asp4 < gtfB < gtfA < secA2 < asp3 < asp2 < asp1 < secY2 < SP70585_RS08960 < SP70585_RS08965 < SP70585_RS08970
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]