Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 15-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_RS10840 [old locus tag: SP70585_2184 ]
- pan locus tag?: PNEUPAN003743000
- symbol: argR
- pan gene symbol?: argR1
- synonym:
- product: arginine repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_RS10840 [old locus tag: SP70585_2184 ]
- symbol: argR
- product: arginine repressor
- replicon: chromosome
- strand: -
- coordinates: 1993984..1994430
- length: 447
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012468 (1993984..1994430) NCBI
- BioCyc: SP70585_RS10840 BioCyc
- MicrobesOnline: see SP70585_2184
- PneumoBrowse for strain D39V: SPV_1904 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGAAAAAGAGATCGTCATCAGTTAATAAAAAAAATGATTACTGAGGAGAAATTAAGT
ACACAAAAAGAAATTCAAGATCGGTTGGAGGCGCACAATGTTTGTGTGACGCAGACAACC
TTGTCTCGTGATTTGCGCGAAATCGGCTTGACCAAGGTCAAGAAAAATGATATGGTGTAT
TATGTACTAGTAAATGAGACAGAAAAGATTGATTTGGTGGAATTTTTGTCTCATCATTTA
GAAGGTGTTGCAAGAGCAGAGTTTACCTTGGTGCTTCATACCAAATTGGGAGAAGCCTCT
GTTTTGGCAAATATTGTAGATGTAAACAAGGATGAATGGATTTTAGGAACAGTTGCTGGT
GCCAATACCTTATTGGTTATTTGTCGAGATCAGCACGTTGCCAAACTCATGGAAGATCGT
TTGCTAGATTTGATGAAAGATAAGTAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_RS10840 [old locus tag: SP70585_2184 ]
- symbol: ArgR
- description: arginine repressor
- length: 148
- theoretical pI: 7.14592
- theoretical MW: 17062.8
- GRAVY: -0.269595
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 178.5)Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 178.5)
- TheSEED: see SP70585_2184
- PFAM: HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 96.3)and 3 moreno clan defined Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 54.3)HTH (CL0123) HTH_Tnp_Tc3_2; Transposase (PF01498; HMM-score: 17.1)LRR (CL0022) Recep_L_domain; Receptor L domain (PF01030; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ArgR1*, TF important in Arginine biosynthesis, Arginine degradation: see SP70585_2184
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9836
- Cytoplasmic Membrane Score: 0.0092
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0067
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005853
- TAT(Tat/SPI): 0.001134
- LIPO(Sec/SPII): 0.001185
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001231472 NCBI
- UniProt: see SP70585_2184
⊟Protein sequence[edit | edit source]
- MRKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNETEKIDLVEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAKLMEDRLLDLMKDK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: AhrC*, ArgR1* see SP70585_2184
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1904 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Tomas G Kloosterman, Oscar P Kuipers
Regulation of arginine acquisition and virulence gene expression in the human pathogen Streptococcus pneumoniae by transcription regulators ArgR1 and AhrC.
J Biol Chem: 2011, 286(52);44594-605
[PubMed:22084243] [WorldCat.org] [DOI] (I p)