Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 49619
- locus tag: SPAT_0767 [new locus tag: EL263_RS04110 ]
- pan locus tag?: PNEUPAN001779000
- symbol: SPAT_0767
- pan gene symbol?: flaR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAT_0767 [new locus tag: EL263_RS04110 ]
- symbol: SPAT_0767
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 767737..768144
- length: 408
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP018938 (767737..768144) NCBI
- BioCyc: see EL263_RS04110
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361GTGGTAATAGGTGTGCTAGATTCTAAGGAGGAATTGAAAGAGTCAGAAAATGATGCTCCA
AAACTAGAAACTCCTCTTAGAGAGGAGCCAAGACTAGCTCCTCAAACGCTTCCGGAAGCA
AGTGAAGTTCTTGAAAACAAAAGGGAAGAGTCAAAAGTAGAGATAACAGAGCCAGCTCAA
GCGGATGATATCCGCAAGGTTGTTGGGGAATTAGCCAAGGATATAAGTATTACTAAGTTG
TATATGACAGGTCATTCTCTTGGAGGCTACCTAGCTCAGATTGCAGCGGTTGAAGATTAC
CAAAAATATCCTGATTTTTATAACCATGTATTGAGGAAAGTGACAACTTTCAGTGCTCCT
AAAGTCATTACTTCCAGAACTGTTTGGGATGCTAAGAATGGTTTCTGA60
120
180
240
300
360
408
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAT_0767 [new locus tag: EL263_RS04110 ]
- symbol: SPAT_0767
- description: hypothetical protein
- length: 135
- theoretical pI: 4.74328
- theoretical MW: 15177.1
- GRAVY: -0.534815
⊟Function[edit | edit source]
- TIGRFAM: proline-specific peptidase (TIGR01250; HMM-score: 15.6)glutaredoxin (TIGR02180; HMM-score: 14.4)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 13.9)and 1 moreEnergy metabolism Other 3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 11.1)
- TheSEED: data available for Hungary19A-6
- PFAM: AB_hydrolase (CL0028) Lipase_3; Lipase (class 3) (PF01764; HMM-score: 31.1)and 12 moreHydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 18.2)Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 16.5)DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 16)PGAP1; PGAP1-like protein (PF07819; HMM-score: 14.5)Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 14.3)Mbeg1-like; Mbeg1-like (PF11187; HMM-score: 14.2)Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 13.7)LIDHydrolase; Lipid-droplet associated hydrolase (PF10230; HMM-score: 13.5)BD-FAE; BD-FAE (PF20434; HMM-score: 13.4)Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 13)DUF676; Putative serine esterase (DUF676) (PF05057; HMM-score: 12.7)Esterase; Putative esterase (PF00756; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0022
- Cytoplasmic Membrane Score: 0.0052
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.9918
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007374
- TAT(Tat/SPI): 0.001315
- LIPO(Sec/SPII): 0.001688
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG38824 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVIGVLDSKEELKESENDAPKLETPLREEPRLAPQTLPEASEVLENKREESKVEITEPAQADDIRKVVGELAKDISITKLYMTGHSLGGYLAQIAAVEDYQKYPDFYNHVLRKVTTFSAPKVITSRTVWDAKNGF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]