Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 16-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae CGSP14
- locus tag: SPCG_RS00950 [old locus tag: SPCG_0176 ]
- pan locus tag?: PNEUPAN000861000
- symbol: SPCG_RS00950
- pan gene symbol?: —
- synonym:
- product: sigma-70 family RNA polymerase sigma factor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPCG_RS00950 [old locus tag: SPCG_0176 ]
- symbol: SPCG_RS00950
- product: sigma-70 family RNA polymerase sigma factor
- replicon: chromosome
- strand: +
- coordinates: 179932..180354
- length: 423
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAACCATCTTCTTTTCAGACCACAATAGAAAATCAGTTTGACTATATCTGTAAACGT
GCTATGGAAGACGAGCGAAAGAATTATATGCTTTATCTTTCAAGGATTGCAAAGCGTGAG
GTGTCCTTTTCGGATGTTGGCGATTATCTTGTTAGCCAGTTTGCGACAACAGATAACTAT
TCAACTGACTTTCAGATTTTTACACTCAATGGGTTATCAGTAGGCGTTGAAAATGATTTG
TTGAGTGAAGCATTACGTGAGTTGCCAGACAAGAAACGTGAAATTCTACTGCTGTTTTAC
TTTATGGACATGAGCGATTCAGAAATTGCAGACCTGTTGAAATTGAACCGTTCTACTGTC
TATCGGCATAGAACCAGTGGACTAGCCTTAATTAAAAAGTTTATGGAGGAATTTGAAGAA
TGA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPCG_RS00950 [old locus tag: SPCG_0176 ]
- symbol: SPCG_RS00950
- description: sigma-70 family RNA polymerase sigma factor
- length: 140
- theoretical pI: 4.60339
- theoretical MW: 16460.6
- GRAVY: -0.383571
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 45.9)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 39.3)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 37.3)and 16 moreRNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 29.9)RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 28.4)RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 26.2)RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 25.8)RNA polymerase sigma-W factor (TIGR02948; HMM-score: 25.1)RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 23.3)RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 21.9)Cellular processes Sporulation and germination RNA polymerase sigma-E factor (TIGR02835; HMM-score: 21.1)Transcription Transcription factors RNA polymerase sigma-E factor (TIGR02835; HMM-score: 21.1)transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.8)Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 20.3)Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 20.3)RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 19.9)RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 15)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 13.8)RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 13.2)
- TheSEED: see SPCG_0176
- PFAM: HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 41.2)and 12 moreSigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 30.5)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 22.9)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 20.5)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 17.5)Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 16)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 15.9)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.3)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 14.7)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.5)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.1)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9153
- Cytoplasmic Membrane Score: 0.0651
- Cell wall & surface Score: 0.0018
- Extracellular Score: 0.0178
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00635
- TAT(Tat/SPI): 0.000519
- LIPO(Sec/SPII): 0.000832
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000804885 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFSDVGDYLVSQFATTDNYSTDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFMDMSDSEIADLLKLNRSTVYRHRTSGLALIKKFMEEFEE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.