Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_0026 [new locus tag: SPG_RS00130 ]
- pan locus tag?: PNEUPAN000508000
- symbol: SPG_0026
- pan gene symbol?: tadA
- synonym:
- product: Cytosine/adenosine deaminase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_0026 [new locus tag: SPG_RS00130 ]
- symbol: SPG_0026
- product: Cytosine/adenosine deaminase
- replicon: chromosome
- strand: +
- coordinates: 23424..23744
- length: 321
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (23424..23744) NCBI
- BioCyc: see SPG_RS00130
- MicrobesOnline: 5755295 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0025 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTATTATACGCTTGAAGAAAAAGAAGTCTTTATGAGGGAGGCTTTGAGAGAGGCTGAG
ATTGCTCTTGAACACGATGAAATTCCAATTGGTTGTGTGATTGTCAAAGATGGGGAAATC
ATTGGTCGTGGGCATAATGCGCGTGAGGAATTACAGCGAGCGGTTATGCATGCGGAAATT
ATGGCTATAGAGGATGCGAACTTGAGTGAGGAGAGCTGGCGCTTGCTGGATTGCACACTT
TTTGTGACCATTGAACCTTGTGTCATGTGTAGTGGAGCGATTGGGCTTGCCCGCATTCCC
AAATGTGGTCTATGGGGCTAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_0026 [new locus tag: SPG_RS00130 ]
- symbol: SPG_0026
- description: Cytosine/adenosine deaminase
- length: 106
- theoretical pI: 4.34398
- theoretical MW: 11948.8
- GRAVY: 0.0764151
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Riboflavin, FMN, and FAD riboflavin biosynthesis protein RibD (TIGR00326; EC 1.1.1.193,3.5.4.26; HMM-score: 41.6)and 1 moreComE operon protein 2 (TIGR02571; HMM-score: 12.5)
- TheSEED :
- tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)
- PFAM: CDA (CL0109) MafB19-deam; MafB19-like deaminase (PF14437; HMM-score: 91.6)dCMP_cyt_deam_1; Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383; HMM-score: 87.1)and 6 moreSNAD4; Secreted Novel AID/APOBEC-like Deaminase 4 (PF18750; HMM-score: 17.6)APOBEC_N; APOBEC-like N-terminal domain (PF08210; HMM-score: 17)Bd3614-deam; Bd3614-like deaminase (PF14439; HMM-score: 14.9)NAD1; Novel AID APOBEC clade 1 (PF18778; HMM-score: 14.4)APOBEC4_like; APOBEC4-like -AID/APOBEC-deaminase (PF18774; HMM-score: 14.2)APOBEC2; APOBEC2 (PF18772; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9863
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0117
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001617
- TAT(Tat/SPI): 0.000305
- LIPO(Sec/SPII): 0.000504
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56556 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGHNAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPKCGLWG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0025 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.