Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_0677 [new locus tag: SPG_RS03425 ]
- pan locus tag?: PNEUPAN001688000
- symbol: SPG_0677
- pan gene symbol?: clpP
- synonym:
- product: ATP-dependent Clp protease proteolytic subunit
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_0677 [new locus tag: SPG_RS03425 ]
- symbol: SPG_0677
- product: ATP-dependent Clp protease proteolytic subunit
- replicon: chromosome
- strand: +
- coordinates: 661553..661996
- length: 444
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (661553..661996) NCBI
- BioCyc: see SPG_RS03425
- MicrobesOnline: 5755946 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0650 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCTTACGATATTTACTCA
CGTCTTCTCAAAGACCGCATCATTATGCTGACAGGTCCGGTTGAAGACAATATGGCTAAC
TCTGTTATTGCCCAATTGCTTTTCTTGGATGCCCAAGATAGTACAAAAGATATTTACCTT
TATGTCAATACACCAGGTGGTTCTGTTTCAGCTGGTTTGGCAATCGTANATACCATGAAC
TTTATCAAGGCAGATGTCCAAACCATTGTTATGGGAATGGCTGCATCTATGGGAACAGTC
ATCGCATCAAGTGGAGCAAAAGGCAAACGTTTCATGCTTCCAAATGCTGAATACATGATT
CATCAACCAATGGGCGGTACAGGTGGTGGTACCCAACAAACTGATATGGCTATCGCTGCA
GAACACTTGCTCAAAAATTCGTAA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_0677 [new locus tag: SPG_RS03425 ]
- symbol: SPG_0677
- description: ATP-dependent Clp protease proteolytic subunit
- length: 147
- theoretical pI: 5.68229
- theoretical MW: 15646
- GRAVY: 0.120548
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp endopeptidase, proteolytic subunit ClpP (TIGR00493; EC 3.4.21.92; HMM-score: 221.7)and 2 moreProtein fate Degradation of proteins, peptides, and glycopeptides signal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 22.5)Protein fate Degradation of proteins, peptides, and glycopeptides signal peptide peptidase SppA, 67K type (TIGR00705; EC 3.4.-.-; HMM-score: 22.3)
- TheSEED :
- ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)
Protein Metabolism Protein degradation Proteolysis in bacteria, ATP-dependent ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)and 1 more - PFAM: ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 194.5)and 1 moreSDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 17.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.3907
- Cytoplasmic Membrane Score: 0.3553
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.2531
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003116
- TAT(Tat/SPI): 0.000418
- LIPO(Sec/SPII): 0.000546
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56558 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVXTMNFIKADVQTIVMGMAASMGTVIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKNS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CtsR (repression) regulon
CtsR (TF) important in Heat shock response; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0650 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ju Cao, Yi Gong, ShanShan Dong, Liping Zhang, Xaiofei Lai, Xuemei Zhang, Yibing Yin
Pneumococcal ClpP modulates the maturation and activation of human dendritic cells: implications for pneumococcal infections.
J Leukoc Biol: 2013, 93(5);737-49
[PubMed:23381472] [WorldCat.org] [DOI] (I p)