Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_1097 [new locus tag: SPG_RS05530 ]
- pan locus tag?: PNEUPAN002443000
- symbol: SPG_1097
- pan gene symbol?: ahrC
- synonym:
- product: transcriptional repressor
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_1097 [new locus tag: SPG_RS05530 ]
- symbol: SPG_1097
- product: transcriptional repressor
- replicon: chromosome
- strand: -
- coordinates: 1074446..1074877
- length: 432
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (1074446..1074877) NCBI
- BioCyc: see SPG_RS05530
- MicrobesOnline: 5756366 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1063 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAATAAAAAAGAGAGACTTGAAAAAATTAGAAGATTGGTGACAGATTATCAAATCGGC
ACGCAAGAAGAAATTGTAGAACATTTGAAAGAAGCAGGTATCACTGCCACTCAGGCGACG
GTATCCCGAGATATCAAAGAGTTAGGTATTGTCAAAATTCCTTTGAGAGACAACACCTAT
GTCTACGAATTGCCAAAATCAATCGTAAAAAGTCTGCAACTGGCTGAAGACAATATCGAA
TCGGCTGAATTGATGGATAAGATGATCAATCTCCAAGTTATTCCAGGAAATACGGCTTTT
GTAAAAGCTCAGTTAATCGATACTTTTGCAGACAAGATTTTTAGTTGTTTGACTGATGAT
AGCTCGATTTTAGTCATTGCCAGAAGTGGAAGTCTAGCAGAGGAAATCTTTGAACAAGTA
AAAAATTGGTAG60
120
180
240
300
360
420
432
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_1097 [new locus tag: SPG_RS05530 ]
- symbol: SPG_1097
- description: transcriptional repressor
- length: 143
- theoretical pI: 4.71283
- theoretical MW: 16183.5
- GRAVY: -0.164336
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 95.1)Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 95.1)and 1 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (TIGR00612; EC 1.17.7.1; HMM-score: 11.9)
- TheSEED :
- Arginine repressor ArgR, putative
- PFAM: HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 82.8)and 5 moreno clan defined Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 38.5)HTH (CL0123) HTH_Tnp_Tc3_2; Transposase (PF01498; HMM-score: 14.8)ACT (CL0070) ACT_8; ACT domain pair (PF19571; HMM-score: 14.1)no clan defined Baculo_p24; Baculovirus P24 capsid protein (PF05073; HMM-score: 13.8)GT-B (CL0113) DUF354; Protein of unknown function (DUF354) (PF04007; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Arginine
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9887
- Cytoplasmic Membrane Score: 0.0056
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0053
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009148
- TAT(Tat/SPI): 0.002248
- LIPO(Sec/SPII): 0.001325
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF55949 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKKERLEKIRRLVTDYQIGTQEEIVEHLKEAGITATQATVSRDIKELGIVKIPLRDNTYVYELPKSIVKSLQLAEDNIESAELMDKMINLQVIPGNTAFVKAQLIDTFADKIFSCLTDDSSILVIARSGSLAEEIFEQVKNW
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1063 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Tomas G Kloosterman, Oscar P Kuipers
Regulation of arginine acquisition and virulence gene expression in the human pathogen Streptococcus pneumoniae by transcription regulators ArgR1 and AhrC.
J Biol Chem: 2011, 286(52);44594-605
[PubMed:22084243] [WorldCat.org] [DOI] (I p)