Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_1638
- pan locus tag?:
- symbol: SPG_1638
- pan gene symbol?: —
- synonym:
- product: serine/threonine protein kinase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_1638
- symbol: SPG_1638
- product: serine/threonine protein kinase
- replicon: chromosome
- strand: -
- coordinates: 1584761..1585090
- length: 330
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (1584761..1585090) NCBI
- BioCyc:
- MicrobesOnline: 5756905 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATCCAAATCGGCAAGATTTTTGCCGGACGCTATCGGATTGTCAAACAGATTGGTCGA
GGAGGTATGGCGGATGTNTACCTAGCCAAAGANTTAATNTTAGATGGGGAAGAAGTGGCA
GTGAAGGTTTTGAGGACCAACTACCAGACGGACCCGATAGCTGTAGCTCGTTTTCAGCGT
GAAGCGAGAGCTATGGCAGATCTAGACCATCCTCATATCGTTCGGATAACAGATATTGGT
GAGGAAGNCGGTCAACAGTATCTTGCAATGGAGTATGTTGCTTGGACTAGACCTCAAACG
CTATATCAAGGAACATTATCCTCTTTCTAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_1638
- symbol: SPG_1638
- description: serine/threonine protein kinase
- length: 109
- theoretical pI: 8.8523
- theoretical MW: 12030.8
- GRAVY: -0.175472
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance TOMM system kinase/cyclase fusion protein (TIGR03903; HMM-score: 39.2)
- TheSEED :
- Serine/threonine protein kinase PrkC, regulator of stationary phase
A Gram-positive cluster that relates ribosomal protein L28P to a set of uncharacterized proteins Serine/threonine protein kinase PrkC, regulator of stationary phaseand 1 more - PFAM: PKinase (CL0016) Pkinase; Protein kinase domain (PF00069; HMM-score: 49.7)and 4 morePK_Tyr_Ser-Thr; Protein tyrosine and serine/threonine kinase (PF07714; HMM-score: 39.6)ABC1; ABC1 atypical kinase-like domain (PF03109; HMM-score: 15.5)no clan defined MRP-63; Mitochondrial ribosome protein 63 (PF14978; HMM-score: 13.7)Herpes_gp2; Equine herpesvirus glycoprotein gp2 (PF05955; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001204
- TAT(Tat/SPI): 0.000179
- LIPO(Sec/SPII): 0.000274
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56840 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIQIGKIFAGRYRIVKQIGRGGMADVYLAKXLXLDGEEVAVKVLRTNYQTDPIAVARFQREARAMADLDHPHIVRITDIGEEXGQQYLAMEYVAWTRPQTLYQGTLSSF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.