Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_1578 [new locus tag: SPH_RS07645 ]
- pan locus tag?: PNEUPAN002745000
- symbol: SPH_1578
- pan gene symbol?: mgsR
- synonym:
- product: arsenate reductase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_1578 [new locus tag: SPH_RS07645 ]
- symbol: SPH_1578
- product: arsenate reductase
- replicon: chromosome
- strand: -
- coordinates: 1457608..1457964
- length: 357
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (1457608..1457964) NCBI
- BioCyc: see SPH_RS07645
- MicrobesOnline: 5696405 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1291 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTAGAATTTATCGAATACCCCAAATGTTCAACTTGTAAAAAAGCAAAACAAGAATTA
AATCAATTAGGTGTGGACTATAAAGCCGTCCATATCGTGGAAGAAACACCTAGCCAAGAA
GTCATTTTGAATTGGCTAGAAACCTCAGGATTTGAATTGAAGCAATTTTTCAACACCAGT
GGTATCAAATACCGTGAATTAGGGCTAAAAGATAAGGTAGGAAGTTTGTCAAACCAAGAA
GCGGCTGAGTTGCTAGCAAGTGACGGTATGTTGTTAAAACGGCCCATTTTAGTAGAAAAT
GGAACTGTTAAGCAAATCGGTTATCGAAAATCTTATGAAGAACTGGGACTGAAATAG60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_1578 [new locus tag: SPH_RS07645 ]
- symbol: SPH_1578
- description: arsenate reductase
- length: 118
- theoretical pI: 5.9475
- theoretical MW: 13387.3
- GRAVY: -0.380508
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 101.7)and 8 moreCellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 37.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 33.1)Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 26.5)glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 20.6)glutaredoxin-like protein (TIGR02200; HMM-score: 18.8)glutaredoxin-family domain (TIGR02190; HMM-score: 18.7)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 16.3)Energy metabolism Electron transport monothiol glutaredoxin, Grx4 family (TIGR00365; HMM-score: 13.3)
- TheSEED :
- Uncharacterized Spx/MgsR-like protein YusI
- PFAM: Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 47.2)and 2 moreGlutaredoxin; Glutaredoxin (PF00462; HMM-score: 24.9)GST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 16.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9789
- Cytoplasmic Membrane Score: 0.0136
- Cell wall & surface Score: 0.0013
- Extracellular Score: 0.0061
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002544
- TAT(Tat/SPI): 0.000152
- LIPO(Sec/SPII): 0.000696
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNWLETSGFELKQFFNTSGIKYRELGLKDKVGSLSNQEAAELLASDGMLLKRPILVENGTVKQIGYRKSYEELGLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1291 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]