Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_RS10600
- pan locus tag?: PNEUPAN003642000
- symbol: rpmG
- pan gene symbol?: rpmG2
- synonym:
- product: 50S ribosomal protein L33
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_RS10600
- symbol: rpmG
- product: 50S ribosomal protein L33
- replicon: chromosome
- strand: -
- coordinates: 1988270..1988422
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_010380 (1988270..1988422) NCBI
- BioCyc: SPH_RS10600 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2423 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCACTAAAAAAAGCAAGCCTAGCTTGTGCGGTTTGTGGTTCGAGAAACTATTCAATC
AAGATCAGCGGAAACCCCAAGCCTACACGACTAGAAGTAAATAAATTTTGTAAGCATTGT
GGCAAGTACACTACACACAGAGAAACGAGATAG60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_RS10600
- symbol: RpmG
- description: 50S ribosomal protein L33
- length: 50
- theoretical pI: 10.5513
- theoretical MW: 5598.57
- GRAVY: -0.63
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL33 (TIGR01023; HMM-score: 39.9)
- TheSEED: data available for TIGR4
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 54.7)and 6 morezf-RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 20.2)Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 15.8)zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 15.6)zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 13.1)OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 12.9)no clan defined DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4431
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.5563
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.215729
- TAT(Tat/SPI): 0.010293
- LIPO(Sec/SPII): 0.049018
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001809375 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MALKKASLACAVCGSRNYSIKISGNPKPTRLEVNKFCKHCGKYTTHRETR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2423 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]