Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae JJA
- locus tag: SPJ_1321 [new locus tag: SPJ_RS06565 ]
- pan locus tag?: PNEUPAN002699000
- symbol: SPJ_1321
- pan gene symbol?: —
- synonym:
- product: conserved domain protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPJ_1321 [new locus tag: SPJ_RS06565 ]
- symbol: SPJ_1321
- product: conserved domain protein
- replicon: chromosome
- strand: -
- coordinates: 1266215..1266424
- length: 210
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000919 (1266215..1266424) NCBI
- BioCyc: see SPJ_RS06565
- MicrobesOnline: 7479582 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1253 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGGCTAAAAATTTAAAATTAAAATTAGCTCGGGTAGAGCGTGATTTAACACAAGGTCAA
CTGGCAGAGGCTGTCGGGGTGACGCGCCAGACTATTGGTTTGATAGAAGCGGGGAAATAC
AATCCCAGTCTCTCGCTCTGCCAGTCCATTTGCAGATGTTTAGGGAAAACCCTAGACCAA
CTATTTTGGGAGGAAGAAGATGAAAAATAG60
120
180
210
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPJ_1321 [new locus tag: SPJ_RS06565 ]
- symbol: SPJ_1321
- description: conserved domain protein
- length: 69
- theoretical pI: 6.49057
- theoretical MW: 7751.93
- GRAVY: -0.330435
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 42.6)and 5 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 14.5)probable regulatory domain (TIGR03879; HMM-score: 14.1)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 13.7)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 13.7)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 13.7)
- TheSEED :
- Transcriptional repressor
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 57.1)and 12 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.7)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 30.5)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 19.4)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 17.6)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 17.5)MarR_2; MarR family (PF12802; HMM-score: 15.6)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 15.4)HTH_11; HTH domain (PF08279; HMM-score: 14.6)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.5)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 14.2)YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 13.4)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9904
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0086
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029112
- TAT(Tat/SPI): 0.002648
- LIPO(Sec/SPII): 0.001566
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKNLKLKLARVERDLTQGQLAEAVGVTRQTIGLIEAGKYNPSLSLCQSICRCLGKTLDQLFWEEEDEK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1253 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]