Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN034156
- locus tag: SPN034156_04000 [new locus tag: SPN034156_RS02145 ]
- pan locus tag?: PNEUPAN002782000
- symbol: SPN034156_04000
- pan gene symbol?: bta
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN034156_04000 [new locus tag: SPN034156_RS02145 ]
- symbol: SPN034156_04000
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 411746..412093
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312045 (411746..412093) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1327 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGAACAATTTTTAGATAACATCAAAGACCTTGAAGTCACTACAGTTGTGCGTGCGCAA
GAAGCTCTTGATAAAAAAGAAACTGCAACCTTCTTTATCGGTCGCAAAACTTGCCCTTAC
TGCCGTAAATTTGCAGGTGCATTGTCAGGTGTCGTAGCTGAAACCAAAGCTCACATTTAC
TTCATCAATAGTGAAGAACCAAGCCAACTCAATGATTTGCAAGCATTCCGCTCACGCTAT
GGAATCCCAACTGTACCAGGTTTTGTTCATATTACAGATGGACAAATCAACGTCCGTTGC
GACTCTTCAATGTCAGCACAAGAAATCAAAGATTTCGCAGGATTGTAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN034156_04000 [new locus tag: SPN034156_RS02145 ]
- symbol: SPN034156_04000
- description: conserved hypothetical protein
- length: 115
- theoretical pI: 5.72652
- theoretical MW: 12836.5
- GRAVY: -0.213913
⊟Function[edit | edit source]
- TIGRFAM: putative bacteriocin transport accessory protein (TIGR01295; HMM-score: 155.7)and 4 moretype-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 21.2)glutaredoxin (TIGR02180; HMM-score: 18.2)type-F conjugative transfer system pilin assembly protein TrbC (TIGR02742; HMM-score: 12.7)TraF-like protein (TIGR02740; HMM-score: 11.5)
- TheSEED :
- Bacterocin transport accessory protein
- PFAM: Thioredoxin (CL0172) Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 19)TraF; F plasmid transfer operon protein (PF13728; HMM-score: 19)Thioredoxin; Thioredoxin (PF00085; HMM-score: 17.4)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 17.4)AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 16.3)Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 16.2)and 3 moreCDA (CL0109) MafB19-deam; MafB19-like deaminase (PF14437; HMM-score: 15.2)no clan defined TrbC_Ftype; Type-F conjugative transfer system pilin assembly protein (PF09673; HMM-score: 12.7)Thioredoxin (CL0172) DUF6568; Family of unknown function (DUF6568) (PF20207; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9015
- Cytoplasmic Membrane Score: 0.0038
- Cell wall & surface Score: 0.0074
- Extracellular Score: 0.0874
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019126
- TAT(Tat/SPI): 0.003145
- LIPO(Sec/SPII): 0.00194
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP36069 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFAGALSGVVAETKAHIYFINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSMSAQEIKDFAGL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1327 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]