Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN034183
- locus tag: SPN034183_08980 [new locus tag: SPN034183_RS04885 ]
- pan locus tag?: PNEUPAN002001000
- symbol: SPN034183_08980
- pan gene symbol?: —
- synonym:
- product: putative uncharacterized protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN034183_08980 [new locus tag: SPN034183_RS04885 ]
- symbol: SPN034183_08980
- product: putative uncharacterized protein
- replicon: chromosome
- strand: +
- coordinates: 905553..905852
- length: 300
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312043 (905553..905852) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0884 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACTGAAACAAACTCAGTTCCGGCAGGAGTGATTGTGGTCAGTCTACTTGCCCTCCTA
GGCGTGATTGCCTTCTGGCTGATTCGCCGTAAGAAAGAGTCAGAAATCCAGCAATTAAGC
ACGGAATTGATCAAGGTTCTAGGACAGCTAGATGCAGAAAAAGCGGATAAAAAAGTCCTT
GCCAAAGCCCAAAACCTTCTCCAAGAAACCCTTGATTTCGTGAAAGAAGAAAATGGCTCA
GCAGAGACAGAAACTAAACTAGTAGAGGAGCTTAAAGCAATCCTTGACAAACTCAAGTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN034183_08980 [new locus tag: SPN034183_RS04885 ]
- symbol: SPN034183_08980
- description: putative uncharacterized protein
- length: 99
- theoretical pI: 4.91293
- theoretical MW: 10974.8
- GRAVY: 0.010101
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 14.3)Cell envelope Surface structures PEP-CTERM protein-sorting domain (TIGR02595; HMM-score: 12.7)MYXO-CTERM domain (TIGR03901; HMM-score: 11.8)Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 11.6)and 1 moreSH3 domain protein (TIGR04211; HMM-score: 6.2)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 17.5)DUF4868; Domain of unknown function (DUF4868) (PF16162; HMM-score: 14.1)and 5 moreDUF3053; Protein of unknown function (DUF3053) (PF11254; HMM-score: 13.9)Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 13.2)4H_Cytokine (CL0053) LIF_OSM; LIF / OSM family (PF01291; HMM-score: 13)MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 12.2)no clan defined DUF4301; Domain of unknown function (DUF4301) (PF14134; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.9304
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0691
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007076
- TAT(Tat/SPI): 0.00086
- LIPO(Sec/SPII): 0.002575
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP32608 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTETNSVPAGVIVVSLLALLGVIAFWLIRRKKESEIQQLSTELIKVLGQLDAEKADKKVLAKAQNLLQETLDFVKEENGSAETETKLVEELKAILDKLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0884 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]