Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 06-FEB-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F21950 [new locus tag: SPN23F_RS11285 ]
- pan locus tag?: PNEUPAN003855000
- symbol: SPN23F21950
- pan gene symbol?: levE_2
- synonym:
- product: putative PTS system, mannose-specific IIAB component
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F21950 [new locus tag: SPN23F_RS11285 ]
- symbol: SPN23F21950
- product: putative PTS system, mannose-specific IIAB component
- replicon: chromosome
- strand: -
- coordinates: 2143054..2143524
- length: 471
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FM211187 (2143054..2143524) NCBI
- BioCyc: see SPN23F_RS11285
- MicrobesOnline: 5832028 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1991 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTCTATAGAGTTTGTTCGTATTGATGACCGTCTGGTACATGGTCAAGTTGTCACTACG
TGGCTAAAAAAGTATGATATTGAGCAAGTTATCATTGTTAATGATCGCATCTCAGAAGAT
AAAACACGACAATCTATTTTAAAGATTTCTGCACCGGTAGGTTTAAAAATTGTTTTCTTT
AGTGTAAAACGGTTTGTGGAAGTTTTAAACTCTGTGCCAATAAAAAAGAGAACAATGCTG
ATATATACAAATCCAAAAGATGTGTATGATTCTATTGAAGGAAATTTAAAATTGGAGTAC
CTCAATGTAGGACAGATGAGTAAAACGGAGGAAAATGAAAAGGTAACGGGAGGTGTAGCT
CTAGGTGAAGAAGACAAATATTATTTTAAGAAAATAGTTGATAAGGGAACGAGAGTTGAA
ATTCAAATGGTTCCTAATGATAAAGTTACAATGTTGGAAAAATTTTTATAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F21950 [new locus tag: SPN23F_RS11285 ]
- symbol: SPN23F21950
- description: putative PTS system, mannose-specific IIAB component
- length: 156
- theoretical pI: 9.23108
- theoretical MW: 18046.9
- GRAVY: -0.230128
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, mannose/fructose/sorbose family, IIB component (TIGR00854; EC 2.7.1.69; HMM-score: 122.8)Signal transduction PTS PTS system, mannose/fructose/sorbose family, IIB component (TIGR00854; EC 2.7.1.69; HMM-score: 122.8)
- TheSEED :
- Predicted L-fucose-specific phosphotransferase system, EIIB component
- PFAM: no clan defined PTSIIB_sorb; PTS system sorbose subfamily IIB component (PF03830; HMM-score: 155.3)and 2 moreMComp1; ABC-three component (ABC-3C) system Middle Component 1 (PF20289; HMM-score: 15.5)Holin_9; Putative holin (PF16936; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9358
- Cytoplasmic Membrane Score: 0.0008
- Cell wall & surface Score: 0
- Extracellular Score: 0.0633
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001839
- TAT(Tat/SPI): 0.000133
- LIPO(Sec/SPII): 0.000512
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CAR69928 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSIEFVRIDDRLVHGQVVTTWLKKYDIEQVIIVNDRISEDKTRQSILKISAPVGLKIVFFSVKRFVEVLNSVPIKKRTMLIYTNPKDVYDSIEGNLKLEYLNVGQMSKTEENEKVTGGVALGEEDKYYFKKIVDKGTRVEIQMVPNDKVTMLEKFL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: fucI < SPN23F21910 < SPN23F21920 < SPN23F21930 < SPN23F21940 < SPN23F21950 < SPN23F21960 < fucU < fucA < fucK
⊟Regulation[edit | edit source]
- regulators: FucR* (repression) regulon, CcpA regulon
FucR* (TF) important in Fucose utilization; RegPrecise transcription unit transferred from TIGR4 data RegPrecise CcpA (TF) important in Global catabolite repression; RegPrecise transcription unit transferred from TIGR4 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1991 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]