Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F_RS05485 [old locus tags: SPN23F10800 SPN23F_10800 ]
- pan locus tag?: PNEUPAN002420000
- symbol: nrdH
- pan gene symbol?: nrdH
- synonym:
- product: glutaredoxin-like protein NrdH
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F_RS05485 [old locus tags: SPN23F10800 SPN23F_10800 ]
- symbol: nrdH
- product: glutaredoxin-like protein NrdH
- replicon: chromosome
- strand: +
- coordinates: 1058788..1059006
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_011900 (1058788..1059006) NCBI
- BioCyc: SPN23F_RS05485 BioCyc
- MicrobesOnline: see SPN23F10800
- PneumoBrowse for strain D39V: SPV_1041 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGTAACCGTTTATTCTAAAAACAATTGTGTCCAATGTAAAATGACCAAGCGTTTCTTG
GACAGTAATAATGTCTCTTATCGTGAAATCAATCTTGATGAGCAACCTGAGTACGTCGAT
CAAGTTAAAGAGCTCGGTTTTAGCGCAGCTCCTGTTATCCAAACACCAACTGAAGTCTTT
TCAGGTTTCCAACCAGGAAAACTGAAACAATTAGCATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F_RS05485 [old locus tags: SPN23F10800 SPN23F_10800 ]
- symbol: NrdH
- description: glutaredoxin-like protein NrdH
- length: 72
- theoretical pI: 6.49891
- theoretical MW: 8174.28
- GRAVY: -0.419444
⊟Function[edit | edit source]
- TIGRFAM: glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 116)and 7 moreglutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 58.5)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 32.3)Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 31.2)glutaredoxin-like protein (TIGR02200; HMM-score: 29.3)glutaredoxin (TIGR02180; HMM-score: 21.3)glutaredoxin-family domain (TIGR02190; HMM-score: 19)glutaredoxin-like family (TIGR02189; HMM-score: 12.4)
- TheSEED: see SPN23F10800
- PFAM: Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 55)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9962
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0031
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004551
- TAT(Tat/SPI): 0.000211
- LIPO(Sec/SPII): 0.001043
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000259249 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVTVYSKNNCVQCKMTKRFLDSNNVSYREINLDEQPEYVDQVKELGFSAAPVIQTPTEVFSGFQPGKLKQLA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: nrdH > nrdE > nrdF
⊟Regulation[edit | edit source]
- regulator: NrdR* see SPN23F10800
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1041 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]