Jump to navigation
		Jump to search
		
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 05-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae JJA
 - locus tag: SPJ_RS05475 [old locus tag: SPJ_1097 ]
 - pan locus tag?: PNEUPAN002420000
 - symbol: nrdH
 - pan gene symbol?: nrdH
 - synonym:
 - product: glutaredoxin-like protein NrdH
 
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
 - locus tag: SPJ_RS05475 [old locus tag: SPJ_1097 ]
 - symbol: nrdH
 - product: glutaredoxin-like protein NrdH
 - replicon: chromosome
 - strand: +
 - coordinates: 1061645..1061863
 - length: 219
 - essential: unknown other strains
 
⊟Accession numbers[edit | edit source]
- Location: NC_012466 (1061645..1061863) NCBI
 - BioCyc: SPJ_RS05475 BioCyc
 - MicrobesOnline: see SPJ_1097
 - PneumoBrowse for strain D39V: SPV_1041 PneumoBrowse
 
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGTAACCGTTTATTCTAAAAACAATTGTGTCCAATGTAAAATGACCAAGCGTTTCTTG
GACAGTAATAATGTCTCTTATCGTGAAATCAATCTTGATGAGCAACCTGAGTACGTCGAT
CAAGTTAAAGAGCTCGGTTTTAGCGCAGCTCCTGTTATCCAAACACCAACTGAAGTCTTT
TCAGGTTTCCAACCAGAAAAACTGAAACAATTAGCATAA60
120
180
219 
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPJ_RS05475 [old locus tag: SPJ_1097 ]
 - symbol: NrdH
 - description: glutaredoxin-like protein NrdH
 - length: 72
 - theoretical pI: 4.96436
 - theoretical MW: 8246.34
 - GRAVY: -0.4625
 
⊟Function[edit | edit source]
- TIGRFAM: glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 117.3)and 7 moreglutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 61)Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 32.3)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 32.3)glutaredoxin-like protein (TIGR02200; HMM-score: 29.3)glutaredoxin (TIGR02180; HMM-score: 21.2)glutaredoxin-family domain (TIGR02190; HMM-score: 19)glutaredoxin-like family (TIGR02189; HMM-score: 12.3)
 - TheSEED: see SPJ_1097
 - PFAM: Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 55)
 
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
 - modifications:
 - cofactors:
 - effectors:
 
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
 - Cytoplasmic Membrane Score: 2.5
 - Cellwall Score: 2.5
 - Extracellular Score: 2.5
 - Internal Helices: 0
 
 - DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9965
 - Cytoplasmic Membrane Score: 0.0005
 - Cell wall & surface Score: 0.0001
 - Extracellular Score: 0.0029
 
 - SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003733
 - TAT(Tat/SPI): 0.000187
 - LIPO(Sec/SPII): 0.001128
 
 - predicted transmembrane helices (TMHMM): 0
 
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVTVYSKNNCVQCKMTKRFLDSNNVSYREINLDEQPEYVDQVKELGFSAAPVIQTPTEVFSGFQPEKLKQLA
 
⊟Experimental data[edit | edit source]
- protein localization:
 - interaction partners:
 
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: nrdH > nrdE > nrdF
 
⊟Regulation[edit | edit source]
- regulator: NrdR see SPJ_1097
 
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1041 PneumoExpress
 
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]