⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F_RS10305 [old locus tags: SPN23F20210 SPN23F_20210 ]
- pan locus tag?: PNEUPAN003621000
- symbol: SPN23F_RS10305
- pan gene symbol?: rr11
- synonym:
- product: response regulator transcription factor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F_RS10305 [old locus tags: SPN23F20210 SPN23F_20210 ]
- symbol: SPN23F_RS10305
- product: response regulator transcription factor
- replicon: chromosome
- strand: -
- coordinates: 1961356..1961955
- length: 600
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_011900 (1961356..1961955) NCBI
- BioCyc: SPN23F_RS10305 BioCyc
- MicrobesOnline: see SPN23F20210
- PneumoBrowse for strain D39V: SPV_1798 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAGTATTAGTCGCAGAAGATCAAAGTATGTTGCGAGATGCCATGTGTCAATTGCTC
ACGCTTCAACCAGATGTGGAGTCTGTCCTTCAAGCCAAGAATGGGCAAGAAGCAATCCAA
CTATTAGAAAAGGAGTCTGTAGATATCGCCATCCTTGACGTAGAAATGCCTGTTAAGACA
GGTCTTGAAGTCTTGGAGTGGATACGATCAGAAAAGCTTGAAACAAAGGTGGTTGTGGTG
ACGACCTTCAAGCGTGCTGGGTATTTTGAACGTGCGGTCAAGGCTGGAGTGGATGCTTAT
GTATTAAAGGAACGAAGCATTGCAGACCTCATGCAAACCTTGCACACCGTCCTCGAAGGA
CGCAAGGAGTATTCGCCTGAATTGATGGAAATGGTGATGACCCGTCCCAATCCGTTGACA
GAACAAGAGATTGCTGTCTTAAAGGGAATCGCCCGGGGCTTATCCAACCAAGAAATCGCA
GATCAGCTTTACCTCTCAAACGGAACTATTCGAAACTATGTCACCAATATTCTTTCAAAA
CTGGATGCTGGTAATCGAACAGAGGCAGCTAATATCGCAAAAGAATCTGGTTGGTTATGA60
120
180
240
300
360
420
480
540
600
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F_RS10305 [old locus tags: SPN23F20210 SPN23F_20210 ]
- symbol: SPN23F_RS10305
- description: response regulator transcription factor
- length: 199
- theoretical pI: 4.65392
- theoretical MW: 22265.6
- GRAVY: -0.127638
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 62.2)and 16 moreRegulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 42.8)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 42.8)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 42)transcriptional regulator EpsA (TIGR03020; HMM-score: 41.8)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 32.4)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 31.6)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 31.6)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 31.6)LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 23.5)proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 21)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 20.7)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 20.5)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 18.5)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 16.6)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 13.5)Protein synthesis tRNA and rRNA base modification MiaB-like tRNA modifying enzyme, archaeal-type (TIGR01578; HMM-score: 11.5)
- TheSEED: see SPN23F20210
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 87.7)and 12 moreHTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 65.9)CheY (CL0304) cREC_REC; Cyclic-phosphate processing Receiver domain (PF20274; HMM-score: 21.7)HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.9)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 17.8)HTH_11; HTH domain (PF08279; HMM-score: 16.8)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.4)PBP (CL0177) LysR_substrate; LysR substrate binding domain (PF03466; HMM-score: 14.4)HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 14.3)HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 14)P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 12.5)HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12)no clan defined DUF759; Borrelia burgdorferi protein of unknown function (DUF759) (PF05537; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9971
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0022
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003965
- TAT(Tat/SPI): 0.000206
- LIPO(Sec/SPII): 0.000541
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000866719 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1798 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Wolfgang Haas, Deepak Kaushal, Jack Sublett, Caroline Obert, Elaine I Tuomanen
Vancomycin stress response in a sensitive and a tolerant strain of Streptococcus pneumoniae.
J Bacteriol: 2005, 187(23);8205-10
[PubMed:16291696] [WorldCat.org] [DOI] (P p)Riana Cockeran, Jenny A Herbert, Timothy J Mitchell, Thérèse Dix-Peek, Caroline Dickens, Ronald Anderson, Charles Feldman
Exposure of a 23F serotype strain of Streptococcus pneumoniae to cigarette smoke condensate is associated with selective upregulation of genes encoding the two-component regulatory system 11 (TCS11).
Biomed Res Int: 2014, 2014;976347
[PubMed:25013815] [WorldCat.org] [DOI] (I p)