Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994038
- locus tag: SPN994038_13760 [new locus tag: SPN994038_RS07420 ]
- pan locus tag?: PNEUPAN002973000
- symbol: msmK
- pan gene symbol?: msmK
- synonym: ugpC
- product: multiple sugar-binding transport ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994038_13760 [new locus tag: SPN994038_RS07420 ]
- symbol: msmK
- product: multiple sugar-binding transport ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1398165..1399295
- length: 1131
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312041 (1398165..1399295) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1409 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081ATGGTAGAATTGAATCTTAAAAATATTTACAAAAAATATCCAAACAGCGAACACTATTCA
GTTGAAGATTTCAACTTGAACATCAAAGATAAAGAATTTATCGTTTTCGTAGGACCTTCA
GGATGTGGTAAATCAACTACACTCCGTATGATTGCTGGTCTTGAAGACATTACAGAAGGT
ACTGCATCTATCGATGGCGTAGTTGTCAACGACGTAGCTCCAAAAGACCGTGATATCGCC
ATGGTATTCCAAAACTACGCTCTTTACCCACACATGACTGTTTATGACAACATGGCTTTC
GGTTTGAAATTGCGTAAATACAGCAAAGAAGACATTAACAAACGTGTTCAAGAAGCAGCT
GAAATACTTGGATTGAAAGAATTCTTGGAACGTAAACCAGCTGACCTTTCAGGTGGTCAA
CGTCAACGTGTTGCCATGGGGCGTGCGATTGTCCGTGATGCGAAAGTATTCTTGATGGAC
GAACCTTTGTCAAACTTGGATGCCAAACTTCGTGTATCAATGCGTGCTGAAATCGCTAAA
ATTCACCGTCGTATCGGAGCTACAACTATCTATGTAACTCACGACCAAACAGAAGCGATG
ACACTTGCAGACCGTATCGTTATTATGTCAGCTACTAAGAACCCTGCTGGTACAGGTACT
ATCGGACGTGTAGAACAAATCGGTACTCCTCAAGAAGTTTACAAAAATCCAGTTAACAAA
TTCGTTGCAGGATTCATCGGAAGCCCAGCTATGAACTTCATCACCGTGAAATTGGTTGGT
AGCGAAATTGTTTCTGACGGTTTCCGTTTGAAAGTGCCAGAAGGAGCATTGAAAGTTCTT
CGTGAAAAAGGCTACGAAGGAAAAGAATTGATCTTTGGTATCCGTCCAGAAGACGTGAAT
GCAGAACCTGCTTTCCTTGAAACATTCCCAGACTGTGTTGTAAAAGCGACTATCTCTGTA
TCAGAACTGCTTGGTTCAGAATCTCACCTTTACTGCCAAGTTGGTAAAGACGAGTTTGTT
GCAAAAGTTGATGCTCGTGACTACTTGCAAACAGGTGCAACAGTTGAGCTTGGATTTGAC
TTGAACAAAGCACACTTCTTCGATGTAGAAACTGAAAAAACAATCTACTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1131
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994038_13760 [new locus tag: SPN994038_RS07420 ]
- symbol: MsmK
- description: multiple sugar-binding transport ATP-binding protein
- length: 376
- theoretical pI: 6.02695
- theoretical MW: 41820.8
- GRAVY: -0.178457
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 308.9)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 291)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 255.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 254.2)and 71 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 224.7)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 182.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 171.2)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 167.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 162.3)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 162.3)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 156.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 155.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 148.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 136.9)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 136.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 135.5)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 135.4)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 129.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 128.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 128.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 128.6)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 126)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 125.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 118.7)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 118.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 117.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 113.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 111.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 111.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 111.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 110.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 98.9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 98.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 98.6)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 98.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 98.3)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 97.7)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 96.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 96)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 93.7)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 93.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 93.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 93.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 93.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 92)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 91.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 88.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 85.7)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 85)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 83.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 81.4)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 80)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 74.4)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 74.4)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 74.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 74.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 74.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 72.9)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 65.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 65)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 65)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 63.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 59.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 57.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 54.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 45.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 44.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 42.3)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 40.1)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 33.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 32.6)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 18.3)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.8)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 103.8)and 18 moreOB (CL0021) OB_MalK; MalK OB fold domain (PF17912; HMM-score: 58.7)TOBE_2; TOBE domain (PF08402; HMM-score: 34.7)P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 24.7)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23.6)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 22.9)OB (CL0021) CysA_C_terminal; CysA C-terminal regulatory domain (PF17850; HMM-score: 22.3)P-loop_NTPase (CL0023) AAA_22; AAA domain (PF13401; HMM-score: 20)OB (CL0021) TOBE; TOBE domain (PF03459; HMM-score: 19.8)P-loop_NTPase (CL0023) RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 19)AAA_18; AAA domain (PF13238; HMM-score: 17)AAA_23; AAA domain (PF13476; HMM-score: 16.9)AAA_28; AAA domain (PF13521; HMM-score: 15.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.9)AAA_33; AAA domain (PF13671; HMM-score: 14.2)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.9)AAA_15; AAA ATPase domain (PF13175; HMM-score: 13.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.7)RNA_helicase; RNA helicase (PF00910; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009427
- TAT(Tat/SPI): 0.001239
- LIPO(Sec/SPII): 0.006104
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP31112 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVELNLKNIYKKYPNSEHYSVEDFNLNIKDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGTASIDGVVVNDVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLRKYSKEDINKRVQEAAEILGLKEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATKNPAGTGTIGRVEQIGTPQEVYKNPVNKFVAGFIGSPAMNFITVKLVGSEIVSDGFRLKVPEGALKVLREKGYEGKELIFGIRPEDVNAEPAFLETFPDCVVKATISVSELLGSESHLYCQVGKDEFVAKVDARDYLQTGATVELGFDLNKAHFFDVETEKTIY
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1409 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.