Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994039
- locus tag: SPN994039_09640 [new locus tag: SPN994039_RS05170 ]
- pan locus tag?: PNEUPAN002187000
- symbol: SPN994039_09640
- pan gene symbol?: immR
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994039_09640 [new locus tag: SPN994039_RS05170 ]
- symbol: SPN994039_09640
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 968246..968470
- length: 225
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: FQ312044 (968246..968470) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0951 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTACCAACGGATAAGAGATTTGAGGGAAGATCATGATCTCACTCAAAAGTTTGTTGCA
AATTTACTTTCCTTTTCTCATACAAACTATGCAAAAATTAAGAGAGGAGAGGTTGTCTTA
ACGGCAGATGTTCTTGTGCAGCTTTTTAAACTCTATGACGTTAGTACGGATTACTTATTA
GGACTAACAGATTGTCCAGATAGGATAAAGCGTAAAATAAAATAG60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994039_09640 [new locus tag: SPN994039_RS05170 ]
- symbol: SPN994039_09640
- description: conserved hypothetical protein
- length: 74
- theoretical pI: 9.52297
- theoretical MW: 8730.09
- GRAVY: -0.317568
⊟Function[edit | edit source]
- TIGRFAM: putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 17.5)Fatty acid and phospholipid metabolism Biosynthesis polyhydroxyalkanoate synthesis repressor PhaR (TIGR01848; HMM-score: 14)Regulatory functions DNA interactions polyhydroxyalkanoate synthesis repressor PhaR (TIGR01848; HMM-score: 14)and 4 moreRegulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 13.3)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 11.6)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 11.6)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 11.6)
- TheSEED: data available for D39
- PFAM: HTH (CL0123) HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 41.5)HTH_3; Helix-turn-helix (PF01381; HMM-score: 33.9)and 4 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 32.5)no clan defined Dzip-like_N; Iguana/Dzip1-like DAZ-interacting protein N-terminal (PF13815; HMM-score: 16.4)HTH (CL0123) HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.6)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9349
- Cytoplasmic Membrane Score: 0.0084
- Cell wall & surface Score: 0.0042
- Extracellular Score: 0.0525
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003239
- TAT(Tat/SPI): 0.000523
- LIPO(Sec/SPII): 0.000851
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP34658 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MYQRIRDLREDHDLTQKFVANLLSFSHTNYAKIKRGEVVLTADVLVQLFKLYDVSTDYLLGLTDCPDRIKRKIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0951 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]