⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994039
- locus tag: SPN994039_RS07705 [old locus tag: SPN994039_14260 ]
- pan locus tag?: PNEUPAN003047000
- symbol: SPN994039_RS07705
- pan gene symbol?: mntR
- synonym:
- product: metal-dependent transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994039_RS07705 [old locus tag: SPN994039_14260 ]
- symbol: SPN994039_RS07705
- product: metal-dependent transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1446646..1447296
- length: 651
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_021005 (1446646..1447296) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1450 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGACCCCAAACAAAGAAGACTATCTAAAATGTATTTATGAAATTGGCATAGACCTGCAT
AAGATTACCAACAAGGAAATTGCGGCTCGCATGCAAGTCTCTCCCCCTGCCGTAACTGAA
ATGATCAAACGAATGAAAAGTGAAAATCTCATCCTAAAGGACAAGGAATGTGGCTATCTA
CTGACTGACCTCGGTCTCAAACTGGTCTCTGAGCTCTATCGTAAGCACCGCTTGATTGAA
GTTTTTCTAGTTCATCATTTAGACTATACAAGTGACCAGATTCACGAGGAAGCTGAGGTC
TTGGAACACACTGTCTCTGACCTGTTCGTGGAAAGACTAGATAAACTGCTAGGTTTCCCT
AAAACCTGCCCCCACGGAGGAACTATTCCTGCCAAGGGAGAACTCCTCGTTGAAATCAAT
AACCTCCCACTAGCTGATATCAAGGAAGCTGGCGCCTACCGCCTGACTCGGGTGCACGAT
AGTTTTGACATTCTCCATTATCTGGACAAGCACTCACTTCACATCGGTGACCAGCTCCAA
GTCAAGCAGTTTGATGGCTTCAGCAATACCTTCACTATCCTCAGTAACGACGAGGATTTA
CAAGTGAATATGGACATTGCAAAACAACTCTATGTCGAGAAAATCAACTAA60
120
180
240
300
360
420
480
540
600
651
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994039_RS07705 [old locus tag: SPN994039_14260 ]
- symbol: SPN994039_RS07705
- description: metal-dependent transcriptional regulator
- length: 216
- theoretical pI: 5.74358
- theoretical MW: 24825.4
- GRAVY: -0.268519
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.4)phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 14.6)and 4 moreRNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 13.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 12.7)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 12.7)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 12.6)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) Fe_dep_repr_C; Iron dependent repressor, metal binding and dimerisation domain (PF02742; HMM-score: 93.1)and 19 moreFe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 51.2)MarR; MarR family (PF01047; HMM-score: 31)TRB (CL0206) FeoA; FeoA domain (PF04023; HMM-score: 28.8)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 24.9)MarR_2; MarR family (PF12802; HMM-score: 23.7)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 22.1)HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 18.3)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 13.6)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.5)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.3)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.2)Phage_rep_O; Bacteriophage replication protein O (PF04492; HMM-score: 13.1)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 12.9)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.9)Sigma70_r3; Sigma-70 region 3 (PF04539; HMM-score: 12.8)no clan defined Herpes_UL14; Herpesvirus UL14-like protein (PF03580; HMM-score: 12.6)HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.9)GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 11.5)no clan defined DUF465; Protein of unknown function (DUF465) (PF04325; HMM-score: 11)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by MntR*, TF important in Manganese homeostasis: in TIGR4
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004829
- TAT(Tat/SPI): 0.000221
- LIPO(Sec/SPII): 0.000613
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000188505 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTPNKEDYLKCIYEIGIDLHKITNKEIAARMQVSPPAVTEMIKRMKSENLILKDKECGYLLTDLGLKLVSELYRKHRLIEVFLVHHLDYTSDQIHEEAEVLEHTVSDLFVERLDKLLGFPKTCPHGGTIPAKGELLVEINNLPLADIKEAGAYRLTRVHDSFDILHYLDKHSLHIGDQLQVKQFDGFSNTFTILSNDEDLQVNMDIAKQLYVEKIN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1450 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Jason W Johnston, David E Briles, Lisa E Myers, Susan K Hollingshead
Mn2+-dependent regulation of multiple genes in Streptococcus pneumoniae through PsaR and the resultant impact on virulence.
Infect Immun: 2006, 74(2);1171-80
[PubMed:16428766] [WorldCat.org] [DOI] (P p)Tomas G Kloosterman, Robert M Witwicki, Magdalena M van der Kooi-Pol, Jetta J E Bijlsma, Oscar P Kuipers
Opposite effects of Mn2+ and Zn2+ on PsaR-mediated expression of the virulence genes pcpA, prtA, and psaBCA of Streptococcus pneumoniae.
J Bacteriol: 2008, 190(15);5382-93
[PubMed:18515418] [WorldCat.org] [DOI] (I p)Wouter T Hendriksen, Hester J Bootsma, Angela van Diepen, Silvia Estevão, Oscar P Kuipers, Ronald de Groot, Peter W M Hermans
Strain-specific impact of PsaR of Streptococcus pneumoniae on global gene expression and virulence.
Microbiology (Reading): 2009, 155(Pt 5);1569-1579
[PubMed:19372167] [WorldCat.org] [DOI] (P p)Radha Gupta, Minny Bhatty, Edwin Swiatlo, Bindu Nanduri
Role of an iron-dependent transcriptional regulator in the pathogenesis and host response to infection with Streptococcus pneumoniae.
PLoS One: 2013, 8(2);e55157
[PubMed:23437050] [WorldCat.org] [DOI] (I p)Irfan Manzoor, Sulman Shafeeq, Oscar P Kuipers
Ni2+-Dependent and PsaR-Mediated Regulation of the Virulence Genes pcpA, psaBCA, and prtA in Streptococcus pneumoniae.
PLoS One: 2015, 10(11);e0142839
[PubMed:26562538] [WorldCat.org] [DOI] (I e)