Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 14-DEC-2023
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPNA45
- locus tag: SPNA45_RS09155 [old locus tag: SPNA45_01638 ]
- pan locus tag?: PNEUPAN001260000
- symbol: SPNA45_RS09155
- pan gene symbol?: fabT
- synonym:
- product: fatty acid biosynthesis transcriptional regulator FabT
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNA45_RS09155 [old locus tag: SPNA45_01638 ]
- symbol: SPNA45_RS09155
- product: fatty acid biosynthesis transcriptional regulator FabT
- replicon: chromosome
- strand: -
- coordinates: 1662265..1662699
- length: 435
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_018594 (1662265..1662699) NCBI
- BioCyc: SPNA45_RS09155 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0379 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGACTACCAACGAATCAATGAATATTTAACATCTATATTTAACAATGTCCTTGTAATT
GAGGAAGTGAACTTGAGAGGTAGTCGTTTTAAGGATATCTCCATCAAAGAAATGCATACG
ATTGATGTCATCGGTAAGGCTCCAGATGTGACTCCAAGTCAAGTGTCAAAAGAGTTGATG
GTAACTCTTGGAACTGTTACGACAAGTTTGAACAATTTAGAGCGTAAGGGCTACATTGAG
CGAGTTCGGTCAGAACAGGATCGTCGTGTGGTGCATCTGCATTTGACAAAGAAGGGTCGC
TTGATTCATAGACTGCATAAACGCTTCCACAAGGCCATGGTAGAAAAAATTATTGATGGC
ATGAGCGAGGAAGAAATTGCTGTCATGGGTAAAGGCTTGACTAATCTTTACCAATTTTTG
GAGGATTTGAAATAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNA45_RS09155 [old locus tag: SPNA45_01638 ]
- symbol: SPNA45_RS09155
- description: fatty acid biosynthesis transcriptional regulator FabT
- length: 144
- theoretical pI: 9.70948
- theoretical MW: 16735.3
- GRAVY: -0.379861
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 39)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 31.9)and 5 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 26.5)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 19.3)EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 17.6)Cellular processes Toxin production and resistance type 2 lantibiotic, SP_1948 family (TIGR03893; HMM-score: 13.4)CRISPR-associated protein Cas4/Csa1, subtype I-A/APERN (TIGR01896; HMM-score: 12.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 44)MarR_2; MarR family (PF12802; HMM-score: 40.2)and 18 moreHTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 32.1)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 27.4)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 26.4)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 22.2)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 22.1)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 20.4)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 15.9)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 15.8)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 15.4)Ribosomal_S25; S25 ribosomal protein (PF03297; HMM-score: 14.5)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.4)LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 14.3)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 14.2)no clan defined DNA_pol3_a_NI; DNA polymerase III polC-type N-terminus I (PF14480; HMM-score: 13.7)HTH (CL0123) HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 13.7)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 13.6)TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 13.3)Replic_Relax; Replication-relaxation (PF13814; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9827
- Cytoplasmic Membrane Score: 0.0088
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.008
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009261
- TAT(Tat/SPI): 0.00016
- LIPO(Sec/SPII): 0.000495
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000386347 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIGKAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHRLHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0379 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ying-Jie Lu, Charles O Rock
Transcriptional regulation of fatty acid biosynthesis in Streptococcus pneumoniae.
Mol Microbiol: 2006, 59(2);551-66
[PubMed:16390449] [WorldCat.org] [DOI] (P p)