Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 03-APR-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hu17
- locus tag: SPNHU17_00639 [new locus tag: SPNHU17_RS02930 ]
- pan locus tag?: PNEUPAN001480000
- symbol: SPNHU17_00639
- pan gene symbol?: higA
- synonym:
- product: helix-turn-helix domain protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNHU17_00639 [new locus tag: SPNHU17_RS02930 ]
- symbol: SPNHU17_00639
- product: helix-turn-helix domain protein
- replicon: chromosome
- strand: +
- coordinates: 580236..580502
- length: 267
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP020549 (580236..580502) NCBI
- BioCyc: see SPNHU17_RS02930
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0509 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGGAAGGATGTCTATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGA
GTAGCTATCATGAGCGAGTTGATTGAAGCCAGAAATAAGCAAGGAATCAGTCAGAAAAAG
CTAGAGGAAGTCAGTGGAGTGAGTCAGCCTGTTATAGCTAGGATGGAGACAGGTAAGACT
AGTCCACAGTTGGACACAGTCTTAAAAGTCCTAGCTAGTCTAGGAAAGACACTAGCAGTC
GTTCCACTTGAACAGGGGAAAAGTTGA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNHU17_00639 [new locus tag: SPNHU17_RS02930 ]
- symbol: SPNHU17_00639
- description: helix-turn-helix domain protein
- length: 88
- theoretical pI: 4.82798
- theoretical MW: 9560.08
- GRAVY: -0.106818
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 51.2)and 4 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 22.9)Mobile and extrachromosomal element functions Other probable addiction module antidote protein (TIGR02684; HMM-score: 15.9)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS7 (TIGR01029; HMM-score: 13.9)Cellular processes Detoxification cyanase (TIGR00673; EC 4.2.1.104; HMM-score: 13.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 53.8)and 7 moreHTH_37; Helix-turn-helix domain (PF13744; HMM-score: 33.2)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 26.8)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 20.1)MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 17.8)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.6)Trp_repressor; Trp repressor protein (PF01371; HMM-score: 14.2)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9735
- Cytoplasmic Membrane Score: 0.0053
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0205
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004035
- TAT(Tat/SPI): 0.000903
- LIPO(Sec/SPII): 0.000772
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ARD34246 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEGCLSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEEVSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLEQGKS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0509 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]